Job description Greetings from Eden Critical Care Hospital We are looking for Consultant Cardiologist for our 120 beds NABH accredited hospital at Chandigarh. Interested doctors can call for more details at 7015441217 (HR)& email their CV at - hr@edenhospital.net Role: Cardiologist Industry Type: Medical Services / Hospital Department: Healthcare & Life Sciences Employment Type: Full Time, Permanent Role Category: Doctor Education PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills AngioplastyEchoPacemakerCardiacCardiology AngiographyInterventional CardiologyCath LabTMT
Posted 2 hours ago
•
Typically responds within 2 days
Job description Sales Accountable for maintaining and growing Sales of the company products. Accountable to successfully achieve assigned annual targets. Responsible to achieve monthly maximum incentives against basket parameter in Employee Performance Monitoring Program of the Company. Responsible for increasing quotation conversation ratio. Closed and win quotation should be 40% (Considered Last 28 days Quotation) New Business Development. Responsible to increase customer database and achieve targets. Accountable for expansion of VISL brand (new areas / locations) Collection Responsible for timely collections of payments from customers as per the credit limits and credit period assigned to them. After Sales Service Responsible for resolving customer complaints and ensure customer delight. Take regular feedback from customers regarding products and services offered by VISL. Additional Skills: Strong crisis management and time management skills. Should be assertive and have an eye for detail. Ability to handle multiple tasks and work under pressure by meeting deadlines. Role: Branch Sales Manager (B2B) Industry Type: Retail Department: Sales & Business Development Employment Type: Full Time, Permanent Role Category: Enterprise & B2B Sales Education UG: Any Graduate PG: Any Postgraduate Key Skills Crisis managementAfter sales serviceTime managementRelationshipDatabaseCustomer complaintsEditorPerformance monitoringNew business development
Posted 5 hours ago
•
Typically responds within 2 days
Job description About us HMH is a leading provider of drilling solutions, offering a wide range of products and services that are designed to be the safest and most efficient in the industry. Apart from our expertise in land and offshore operations, we are continuously expanding our knowledge within subsea mining, geothermal, onshore and offshore construction, as well as offshore wind industries. With offices in 16 countries across five continents, HMH maintains a strong global presence. HMH is a frontrunner in developing and providing automation and digital solutions for our drilling customers to support their endeavor to improve efficiency and environmental footprint. Equipped with its brilliant team of engineers, HMH is committed to actively exploring opportunities in other industries. For us, this means new opportunities and challenges that we need creativity and great minds to solve in our efforts to innovate our future. Do you want to join our team At HMH we value our employees. We offer exciting job opportunities that will give you the opportunity to grow in your role and give you the professional development you deserve. In addition to competitive pay and benefits, you will join a casual and inclusive work environment. Our environment is based on respect and having a good day at work, so you can expect to join a knowledgeable, global team who help each other to succeed. Summary We are seeking a skilled developer with 8+ years of experience in designing, developing, and deploying robust microservices using Java and Spring Boot. The ideal candidate should also have expertise in Core Java and Java 8, along with experience in Hibernate and JPA. Proficiency in HTML CSS and JavaScript is required with Strong knowledge on Frameworks like Spring MVC, Hibernate, JPA, Spring Boot, Spring Security. Expertise knowledge on Restful Web Services, Microservices Architecture with hands on MS SQL, GitHub, Jenkins, Azure Cloud Technologies like Azure DevOps, Azure AD, Azure Front Door API Gateway. Job Responsibilities Design, develop, and deploy scalable and robust microservices using Java and Spring Boot . Write clean, efficient, and maintainable code using Core Java and Java 8 features. Implement data persistence using Hibernate and JPA . Develop responsive front-end components using HTML, CSS, and JavaScript . Build and maintain applications using frameworks such as Spring MVC , Spring Security , and Spring Boot . Design and consume RESTful Web Services in a Microservices Architecture . Work with MS SQL for database design, queries, and performance tuning. Utilize GitHub for version control and Jenkins for continuous integration and deployment. Leverage Azure Cloud Technologies , including Azure DevOps , Azure Active Directory (AD) , Azure Front Door , and API Gateway for cloud-based application development and deployment. Collaborate with cross-functional teams to define, design, and ship new features. Ensure the performance, quality, and responsiveness of applications. Troubleshoot and resolve technical issues across the development lifecycle. Required Qualifications Education: Bachelor s degree in Computer Science, Engineering or related discipline Experience: Minimum 7 years of relevant professional level experience Skills and Abilities: Programming Languages: Proficient in Java (Core Java, Java 8) with strong object-oriented programming skills. Frameworks Technologies: Deep expertise in Spring Boot , Spring MVC , Spring Security , Hibernate , and JPA . Web Development: Skilled in HTML , CSS , and JavaScript for building responsive and user-friendly interfaces. Microservices Architecture: Strong understanding and hands-on experience in designing and implementing RESTful APIs and microservices . Database Management: Proficient in MS SQL including schema design, complex queries, and performance optimization. Version Control CI/CD: Experienced with GitHub for source control and Jenkins for continuous integration and deployment. Cloud Platforms: Hands-on experience with Microsoft Azure , including Azure DevOps , Azure Active Di
Posted 1 day ago
•
Typically responds within 2 days
Job description Responsibilities: Perform cosmetic treatments such as facials, lasers, and hair transplants Administer chemical peels and laser treatments Maintain cleanliness and sterility in treatment areas Kindly Contact at: Mob/ Whatsapp: 7240181000 Email: radiantskinclinicjpr@gmail.com Role: Dermatologist Industry Type: Medical Services / Hospital Department: Healthcare & Life Sciences Employment Type: Full Time, Permanent Role Category: Doctor Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills Cosmetology TherapyDermatologyHair CareFillersSkin CarePatient CareFacialLaserPatient CounsellingCosmeticsAestheticsSkinHair TransplantChemical Peels
Posted 1 day ago
•
Typically responds within 2 days
Job description Job Summary: We are looking for passionate and dynamic fresh postgraduates or B.Ed. graduates to join our teaching team for Classes 8-10. The role involves teaching core academic subjects Physics, Chemistry, Mathematics, and Biology while creating an engaging and interactive classroom environment. Key Responsibilities: Deliver clear and effective lessons using real-life examples and experiments. Design lesson plans that align with the prescribed school curriculum. Foster a learning environment that promotes curiosity, inquiry, and problem-solving. Encourage active participation and critical thinking among students. Qualifications & Skills: Master's degree or B.Ed. in the respective subject area. A genuine passion for teaching and connecting with teenagers. Strong communication and classroom management skills. Ability to simplify complex concepts and inspire young minds. Why Join Us? Be part of a nurturing and child-friendly teaching environment. Develop valuable skills in early education and communication training. Opportunity to make a positive impact on foundational student development. Collaborate with a team that values creativity and innovation in education. Role: Teaching & Training - Other Industry Type: Education / Training Department: Teaching & Training Employment Type: Full Time, Permanent Role Category: Teaching & Training - Other Education UG: B.Sc in Any Specialization, B.Ed in Any Specialization PG: MS/M.Sc(Science) in Any Specialization Key Skills Skills highlighted with ‘‘ are preferred keyskills TrainingChemistryMathematicsBiologyPhysics Communication SkillsScience
Posted 1 day ago
•
Typically responds within 2 days
Job description As a senior member of the team, you will have ownership of critical components that execute hundreds of thousands of provisioning actions daily in a dynamic and reusable manner. Our tools are designed to meet customer needs by managing the state of these resources and supporting complex upgrade patterns, ensuring no breaking changes or resource destruction. When updating our service, we must consider our scale, limitations, and customer requirements. The service maintains and upgrades the nodes in the cluster to higher versions of Kubernetes without impacting customer workloads. Our architectural decisions influence the entire Fusion Apps organization, its customers, and tens of thousands of clusters and related OCI resources. You will be responsible for all stages of the software development lifecycle, from requirements gathering to coding, testing, CI/CD, and operational support. read more Key Skills UnixComputer scienceoperational supportNetworkingArchitectureCodingDebuggingJavascriptSoftware development life cycleLoad balancing
Posted 1 day ago
•
Typically responds within 2 days
Job description As a senior member of the team, you will have ownership of critical components that execute hundreds of thousands of provisioning actions daily in a dynamic and reusable manner. Our tools are designed to meet customer needs by managing the state of these resources and supporting complex upgrade patterns, ensuring no breaking changes or resource destruction. When updating our service, we must consider our scale, limitations, and customer requirements. The service maintains and upgrades the nodes in the cluster to higher versions of Kubernetes without impacting customer workloads. Our architectural decisions influence the entire Fusion Apps organization, its customers, and tens of thousands of clusters and related OCI resources. You will be responsible for all stages of the software development lifecycle, from requirements gathering to coding, testing, CI/CD, and operational support. read more Key Skills UnixComputer scienceoperational supportNetworkingArchitectureCodingDebuggingJavascriptSoftware development life cycleLoad balancing
Posted 1 day ago
•
Typically responds within 2 days
Job description 5+ years of working experience with industry-standard messaging systems Apache Kafka, Apache Pulsar, Rabbit MQ.Experience configuring Kafka for large-scale deployments is desirableHands-on experience with building reactive microservices using any popular Java stack.Experience building applications using Java 11 best practices and functional interfaces.Understanding Kubernetes custom operators is desirableExperience building stateful streaming applications using Kafka streams, Apache Flink is a plus.Experience with open telemetry/ tracing / Jaeger is a plus. The role requires proven experience in managing Kafka in large deployments and distributed architectures. Extensive knowledge in configuring Kafka using various industry-driven architectural patterns. You must be passionate about building distributed messaging cloud services running on Oracle Cloud Infrastructure. Experience with pub-sub architectures using Kafka or Pulsar or point-to-point messaging with queues is desirable. Experience building distributed systems with traceability in a high-volume messaging environment. Each team owns its service deployment pipeline to production. read more Key Skills SUBArchitectureCloud ServicesInfrastructureDeploymentManagementOracleApacheDistribution systemmicroservices
Posted 1 day ago
•
Typically responds within 2 days
Job description Terraform, Jenkins, Artifactory, ELK stack for monitoring, GCP cloud aware, Kubernetes, Anthos, GCP Administration Job Summary We are seeking an experienced Infra Ops Specialist with 8 to 12 years of experience to join our team. The ideal candidate will have expertise in Anthos Kubernetes GCP ELK Stack Artifactory Jenkins and Terraform. This role requires domain experience in Commercial Lending. The work model is hybrid with rotational shifts. Travel is not required. Responsibilities read more Key Skills artifactorykubernetescdcontinuous integrationstackproject managementelknetworkingproblem managementchange managementscriptinginfrastructure operationsautomationitsmgcpincident managementjenkinsterraformcommercial lendingcommunication skillsitil
Posted 1 day ago
•
Typically responds within 2 days
Job description Skill/ Position title Sub skills and details Requirement Level of hire Location Spartacus Angular developer Total exp 7+ read more Key Skills cssui developmentbootstrapajaxjquerycodingreact.jsjavahtmlmysqltypescriptapisassmongodbcommunication skillsrestfront endjavascriptsap copaangularnode.jsphpsap controllingperformance optimizationfrontresponsive web designangularjsangular development
Posted 1 day ago
•
Typically responds within 2 days