Job description We believe real value is powered by the unique skills and experiences of our professionals. The interchange of ideas from a diverse group of people gives our teams an expanded perspective and the ability to find better solutions for our clients. Job Title : Manager-DIT GCC Governance and Operations Business Unit sector : CPL-BECIO-CIO Department: BVCPL CIO Work Location : INPUNE Opportunity Type : Staff Relocation eligible : Yes Full time/Part time : Full-Time Contract Hire Only for this Project : No Visa Sponsorship Available : No Job Summary The Manager DIT GCC Governance and Operations is responsible for the Global Competency Center (GCC) team coordination, governing, enabling, and optimizing DIT operations across (GCC). This role reports into the DIT Senior Director India APAC to provide team governance, program oversight, and operational governance across multiple IT domains. The position ensures disciplined execution, risk mitigation, and consistent delivery outcomes while strengthening customer trust and employee engagement across the region. #LI-IB2 Key Responsibilities 1. GCC Team governance Provide governance over projects, programs, and site teams operating in a matrix environment to ensure positive business outcomes. Reinforce a One Team culture across India/APAC, aligned with regional and global DIT priorities. Support workforce planning, employee engagement and demand management in partnership with the DIT Senior Director India APAC. Foster a collaborative, high performance culture focused on accountability, delivery 2. Governance Program Execution Provide governance oversight for a portfolio of DIT programs and initiatives, ensuring alignment to approved scope, timelines, cost, and quality expectations. Implement and run project governance mechanisms, including stage gates, reviews, and executive reporting working closely with PMO related processes. Identify and actively manage risks, dependencies, and issues across programs, ensuring timely resolution and escalation when required. Ensure adherence to approved delivery methodologies, standards, and controls across the GCC. 3. DIT Service Delivery Governance Govern DIT service delivery across functional areas within the GCC. Monitor service performance against defined SLAs, KPIs, and quality metrics, driving corrective actions where gaps exist. Ensure compliance with audit, risk, security, and regulatory requirements through disciplined operational governance. Promote operational excellence through standardization, continuous improvement, and adoption of best practices. 4. Operational Enablement Transformation Contribute to GCC operational maturity by supporting transformation initiatives, capability build out, and service expansion as identified by the DIT Senior Director. Provide governance and oversight for innovation, automation, and process optimization initiatives. Partner with regional stakeholders and local partners to ensure consistent governance and delivery outcomes. Provide oversight on software distribution and ASN management. 5. Reporting Performance Management Produce clear, data driven reports on program, project, and operational performance for DIT Senior Director India APAC. Ensure accurate and timely maintenance of documentation, dashboards, and metrics using approved tools and templates. Drive transparency through meaningful insights, trends, and recommendations for leadership decision making. Preferred Qualifications Strong governance, program management, and risk management capability Excellent communication and stakeholder engagement skills across technical and non technical audiences Strong analytical, reporting, and decision support skills Customer centric mindset with a focus on delivery excellence Minimum Qualifications Education Bachelor s degree in engineering - IT/Software/Computer related field or equivalent experience with a 3-year degree in STEM. Experience 10+ years of total IT experience Minimum 3 years of cross functional experience managing programs, projects, and diverse stakeholder groups Proven experience in governance, service management, and operational governance within large global IT organizations Certifications PMP Certification desired #LI-IB2 Competencies Salary Plan ITS: Information Technology Service Job Grade 018 Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: IT Operations Management Industry Type: Engineering & Construction Department: IT & Information Security Employment Type: Full Time, Permanent Role Category: IT Infrastructure Services Education UG: Any Graduate, B.Tech / B.E. in Any Specialization PG: Any Postgraduate Key Skills Service managementPMPAutomationOperational excellencePerformance managementAnalyticalRisk managementIT operationsOperationsAuditing

Job description Our 30-year journey rides on the passion of over 24,000 seafarers and 1,000 onshore professionals. Today, we are one of the largest independent third-party ship management companies managing over 600 diverse types of vessels. Headquartered in Hong Kong SAR, China, we operate on a global scale having 27 offices in 12 countries. Our client base spans over 100 world-class ship owners, including Fortune 500 companies from China, Greece, India, Japan, Korea, Netherlands, Norway, Turkey and the USA, among others. In a shore career at FLEET, you will be working with a team of a highly passionate, self-driven and committed group of people. We aim to be a place where you can achieve your full potential, regardless of your background. We are looking for individuals who are ambitious about making a strong contribution to FLEET s short and long-term sustainable growth whether you are dealing directly with clients or working in a role supporting the business, such as technology, legal or communications. Job Position Summary The main responsibility of the Drydock Category Management Specialist is to provide support to the Drydock team by delivering drydock cost evaluations, spend and supplier analyses for effective decision making. Drydock Assistant Category Manager will report to the Manager, Drydock Lead and assist in delivering on the category strategies and plans. At times, the Drydock Category Manager will also represent the company in front of various suppliers, as directed from time to time. Key Roles and Responsibilities Participate in establishing the category strategies and support Drydock Lead manager in delivering on the category strategies and plans. Categories included in the scope Drydock Yard bills, Drydock workshops, Stores and Paints. Derive insights from historical drydock data to assist in drydock and stores strategy Assist Drydock category lead in maintaining vessel Drydock data to accurately forecast drydock allocation and identify Drydock standard job scopes and make comparisons of the same with various shortlisted yards Assist Drydock Lead in negotiations with yards on pricing of job scopes in drydocks Perform spot checks of Drydock specification comparison from various yards To provide reports and statistics on drydocks, workshops and category level to support the Drydock category manager and other internal stakeholders in decision making. To assist in performing supplier market analysis and organizing market intelligence for spend within Fleet s operations and benchmarking the comparisons. To assist in developing effective bidding, negotiation, and pricing strategies to provide the business with the best value in the marketplace for the dollars spent in a manner that meets the budgets, policies, ethical standards and audit requirements of the Group. To maintain and contribute to procurement policies and guidelines and ensure compliance of procurement processes and policies for all FML procurement activities. Develop a supplier management program with key category suppliers including metrics, performance goals and improvement initiatives Collaborate and cooperate with cross-functional category teams with the aim of driving cost reduction, improve quality and delivery performance and other applicable key performance areas Job Experience, Functional Knowledge and Qualifications Bachelor s marine engineering degree and at least five (2-3) years Drydock or marine procurement/category management experience. Sailing Marine Engineer with Drydock experience will be preferred Excellent communication and negotiation skills Resourceful, self-driven and proactive Proficient in use of MS Office Application and understanding of supply chain procedures. Strong analytical skills with ability to work on procurement requirements, budgets, cost analysis, cost control and cost savings aspects Ability to understand and adapt technical requirements into procurement processes and related streamlining Fleet Management Limited is committed to diversity, equity and inclusion in the workplace. We prohibit discrimination and harassment of any kind based on race, color, sex, religion, sexual orientation, national origin, disability, genetic information, pregnancy, or any other protected characteristic as outlined by local laws Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Logistics / SCM Analyst Industry Type: Software Product Department: Procurement & Supply Chain Employment Type: Full Time, Permanent Role Category: SCM & Logistics Education UG: Any Graduate PG: Any Postgraduate Key Skills ProcurementSupply chainMarket analysisBiddingFleet managementCost reductionMarket intelligenceCategory managementMS OfficeAuditing

Job description Overview of Job Function: The Product Support Engineer role analyzes and evaluates technical problems and/or functionality questions within the software based on the application, data source or integration with external applications. The role determines the best course of action to resolve the problem or inquiry. Minimum Requirements: 3+ years of customer contact center or customer service experience that supports implementation, and troubleshooting of software applications and related technology infrastructure, or equivalent Demonstrate a continuous passion for learning and growing technical skills Experience with operating systems, desktop domains (active directory) and Windows security Ability to interpret schemas and/or author queries and stored procedures Strong written and verbal communication skills Experience in documenting customer issues with ability to tailor the explanation of technical concepts to the audience Experience in effectively dealing with internal escalations from Verint Professional Services and customer Familiarity with Contact Center operations and technology software and tools Ability to work a flexible schedule in the interest of customer satisfaction; may be required to participate in on-call rotations consistent with Support s on-call practice Customers may request that additional checks be conducted on Verint employees. Verint reserves the right, consistent with applicable law, to require employees in certain positions to undergo background checks periodically or as needed based on our customer s requirements. Preferred Requirements: Bachelor s degree in a technology discipline or related field Familiarity with use of troubleshooting and diagnostic tools such as Wireshark, NetMon, PerfMon, WinDBG, etc. Familiarity with WEB Server Technology (i.e. IIS, WebLogic, Tomcat, Apache) Prior experience with the installation, support, usage or administration of Workforce Management related products or Verint software Understanding of networking and protocols (TCP/IP, SMTP, etc.) Knowledge of telecom systems (CTI, PBX, VOIP) including switches and protocols Familiarity with Information Security (i.e. SSL/PKI, Security hardening, Firewall) Demonstrated experience working with databases (SQL preferred) Ability to interpret schemas and/or author simple queries and stored procedures Ability to author technical articles to document found solution Principal Duties and Essential Responsibilities: Assist Verint Professional Services customer with assigned technical support issues that are reported via telephone, web and email. Provide accurate analysis, troubleshooting and testing of technical issues. Ensure the highest level of communication with the customer to meet Verint s contractual Service level Agreement (SLA) by providing regular updates with respect to progress of each incident, and quickly providing high quality, complete, and timely solutions in a professional manner while demonstrating the highest level of customer service. Facilitate resolutions with Verint s customer contacts and with other members of the Verint organization (sales, services, product house, etc.) as necessary during problem resolution. Technical guidance may be provided by a Senior Product Support Engineer and/or Technical Lead. Follow and maintain all standards for tracking and documenting issues throughout the lifecycle of a support case. Meet or exceed customer satisfaction objectives. Develop knowledge base articles as part of the case management workflow. Demonstrate a complete understanding of the features and functions of assigned products. Develop and maintain product knowledge relevant to product offerings, current support policies and methods of support delivery in order to quickly provide technically accurate and complete resolutions. Deliver internal training on their area of expertise to other members of the team, as necessary. Other duties and responsibilities as assigned. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: System Administrator / Engineer Industry Type: IT Services & Consulting Department: Engineering - Hardware & Networks Employment Type: Full Time, Permanent Role Category: IT Network Education UG: Any Graduate PG: Any Postgraduate Key Skills TelecomNetworkingWorkflowCustomer serviceWindowsTroubleshootingPrincipalTechnical supportProduct supportSQL

Job description Kent is looking for a Lead Engineer- Process, to be based in Mumbai/Vadodara office, who will have around 15+ years relevant Process Design Detail Engineering experience, mostly in the field of Oil Gas, Refinery, Petrochemical or Chemical sector with large EPC companies or Engineering Consulting organizations. You should be effective with verbal and written communication skills. Skills Responsibilities: Review / Process design basis for the project in line with Client and project requirements. Review / provide guidance for preparation of all process discipline design deliverables such as Process datasheets, design criteria, specifications, design calculations, etc. Lead the process discipline efforts in project design reviews. Lead Process discipline efforts in HAZOP studies. Participate in SIL review to give required process inputs. Attend and proactively lead / discuss the process discipline queries with the Client during weekly meetings with Client as required. Perform inter-discipline squad checks for other discipline key deliverables, drawings, etc. Effective interaction with other disciplines to get project issues resolved in a timely manner. Active participation in 3D Model reviews Providing process inputs to other disciplines like mechanical, piping, electrical, instrumentation, civil, etc. Review vendor documents and quotations for compliance with project requirements, and raise technical queries as needed. Review technical reports as submitted by any third-party agency for process activities outsourced if any. Identify skill gaps if any and have a mitigation plan for the same. General guidance to process engineers / designers as appropriate. Shop inspections for FAT/SAT if required. Attend and proactively lead / discuss the process discipline queries with the Client during weekly meetings with Client as required. Site surveys and adequacy checks if required. Attend risk management meetings, value addition meetings, and other safety related meetings as required. Perform technical audits and quality reviews. Site pre-commissioning activities and engineering support as required as per project scope of work. Work out the MFL for the project as per the project schedule and inform HOD well in advance if any additional resource requirements. In addition to the responsibilities listed herein, the employee may be required to perform other ad-hoc tasks as needed or directed by the supervisor or management. These tasks will be within the reasonable scope of the employees skills, capabilities, and role within the organization. The intent of this provision is to allow for flexibility and adaptability in meeting the dynamic needs of the organization, ensuring that operational requirements can be met efficiently. All such tasks will be assigned considering the employees current workload and with respect to their professional development. Knowledge/ Qualification/ Training/ Certification: Education: Bachelor s or Master s degree in Chemical engineering. Experience: 18-20 years of basic and detail engineering experience in Upstream Oil Gas, Refinery, Petrochemical industry. Candidates having experience in Engineering office of Reputed Consulting Engineering Companies preferably in the field of Oil Gas, Refinery, Petrochemicals will be preferred. Knowledge: Oil and gas and/or Refinery experience required. Experience in FEED and detailed engineering of Refinery projects, Upstream oil and gas projects, oil tank farm projects handling petrochemical products, storage, and transportation of petroleum products (liquid/gas) via pipelines, road loading gantries, etc. Must have handled utilities and offsites projects handling utilities required for oil and gas and petrochemical plants. International Codes Standards and Best Engineering Practices that apply to Process design. Quality management system and procedures Project management and control procedures Process workflow and interdisciplinary co-ordination. Project Process Deliverables Project Risk Assessment Adherence to HSE norms by self and team Proficiency in understanding of Process design aspects. Good communication skills as required for effective interaction with Client and the process team Software Skills: Aspen Hysys suite Steady state/Transient hydraulics software KORF, AFT Fathom, AFT Arrow etc. Microsoft Office Suite Communication: Effective verbal and written communication. Identify/report technical concerns and solutions in a clear and concise manner. Attend project and team meeting. Conduct technical training session for team. Behavior/ Core Competencies: Leadership, Decision Making Delegation Teamwork, Coordination, Planning and Organizing, manpower management. Flexibility / Adaptability Business Acumen, Client Focus Training and Mentoring Innovation HSSEQ: The Employee shall observe the Health, Safety, Sustainability, Environment and Quality rules of the Company; it s clients and the governing authorities of the host country. Candidate should contribute to creating a workplace where everyone feels compelled to intervene whenever they observe an unsafe act or condition to ensure that everyone goes home safe and well and the environment is preserved in the successful operation of our business. Candidate should maintain the HSSEQ management system, and the tools required to implement it Details about the role: Location: Mumbai Relocation required: NA Travel required: Sometimes Contract type: Regular Experience level: 15+ Years Foster a culture of equity, diversity and inclusion a safe and respectful workplace. In addition to the responsibilities listed herein, the employee may be required to perform other ad-hoc tasks as needed or directed by the supervisor or management. These tasks will be within the reasonable scope of the employees skills, capabilities, and role within the organization. The intent of this provision is to allow for flexibility and adaptability in meeting the dynamic needs of the organization, ensuring that operational requirements can be met efficiently. All such tasks will be assigned considering the employees current workload and with respect to their professional development. Kent | The Energy Within Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Process Engineer Industry Type: Power Department: Production, Manufacturing & Engineering Employment Type: Full Time, Permanent Role Category: Engineering Education UG: Any Graduate PG: Any Postgraduate Key Skills Process designProject managementConsultingHAZOPInstrumentationEPCRefineryPetrochemicalPetroleumAspen

Job description About the Role We are looking for an experienced Mobile Product Support Engineer to join our Global Technical Support organization. This role is ideal for a technical leader who thrives on solving highly complex mobile-related issues, with a strong focus on customer impact, operational workflows, and regulatory considerations. As a Product Support Engineer, Mobile Experience, you will serve as a senior technical escalation owner responsible for leading complex investigations end-to-end across Samsara s mobile ecosystem. You will work cross-functionally with Engineering and Product teams to drive issue resolution, improve product quality, and influence roadmap decisions that enhance the reliability, compliance, and supportability of Samsara s mobile applications. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. read more Key Skills Data analysisDebuggingTroubleshootingJIRATechnical supportMonitoringProduct supportSQLAndroidPython

Job description About DP World Trade is the lifeblood of the global economy, creating opportunities and improving the quality of life for people around the world. DP World exists to make the world s trade flow better, changing what s possible for the customers and communities we serve globally. With a dedicated, diverse and professional team of more than 111, 000 employees from 159 nationalities, spanning 77 countries on six continents, DP World is pushing trade further and faster towards a seamless supply chain that s fit for the future. We re rapidly transforming and integrating our businesses -- Ports and Terminals, Marine Services, Logistics and Technology and uniting our global infrastructure with local expertise to create stronger, more efficient end-to-end supply chain solutions that can change the way the world trades. Whats more, were reshaping the future by investing in innovation. From intelligent delivery systems to automated warehouse stacking, we re at the cutting edge of disruptive technology, pushing the sector towards better ways to trade, minimizing disruptions from the factory floor to the customer s door. About DP World Global Service Centre DP World s Global Service Centre (GSCs) are key enablers of growth delivering standardization, process excellence and expertise, and automation in areas of Finance, Freight Forwarding, Marine Services, Engineering and Human Resources, helping accelerate DP World s growth and business transformation. As we experience exponential growth, there has never been a more exciting time to join us. Discover your next role here and change whats possible for everyone! As an equal employer that recognizes and values diversity and an inclusive culture, we empower and up-skill our people with opportunities to perform at their best. Join us and be part of an amazing team that is transforming the future of world trade. Role Purpose: Global Freight Forwarding Finance is responsible for managing global intercompany reconciliation activities across Freight Forwarding entities and regions. The role ensures accurate reconciliation, timely resolution of differences, effective intercompany netting and settlement, and compliance with group financial controls. The position serves as a key liaison between Group Finance Team, Regional Finance Teams, Global Shared Service (GSC) Team and Freight Forwarding Operations to support accurate financial reporting and efficient working capital management. Designation: Specialist - Forwarding Finance - Global Service Centre Base Location: Navi Mumbai Reporting to: Asst. Manager -Finance-Freight Forwarding Key Role Responsibilities: Global Intercompany Reconciliation Perform monthly reconciliation of intercompany balances and transactions across global Freight Forwarding entities using Oracle/other system reports for GSC supported entities. Perform intercompany reconciliations between GSC supported entities and other intercompany counterparts on a monthly and ad hoc basis. Investigate and resolve intercompany mismatches, unreconciled balances, and aged open items. Coordinate with GSC Finance teams, Regional Finance teams, and intercompany counterparties to ensure timely resolution of reconciling items. Ensure completion of intercompany reconciliations within agreed timelines. Monitor intercompany ageing and drive corrective actions to minimize outstanding balances. Netting Settlement Management Prepare and execute global intercompany netting and settlement processes for Freight Forwarding entities supported by GSC using Oracle or other prevailing systems. Validate balances included in netting cycles and coordinate with participating entities and GSC Freight Forwarding Finance teams. Track settlement status and ensure timely closure of outstanding intercompany positions. Prepare reports and dashboards related to netting participation and settlement performance. Stakeholder Management Partner with Global Freight Forwarding Finance, Regional Controllers, Global Shared Service Centre, and Operations teams. Facilitate regular governance discussions to review reconciliation status and aged balances. Provide timely updates and escalate critical issues impacting financial close or settlements. Build strong working relationships with GSC teams and global stakeholders to drive issue resolution and ensure process compliance. Controls, Compliance Reporting Ensure compliance with company accounting policies, internal controls, and financial governance requirements. Maintain complete reconciliation documentation with audit ready supporting evidence. Support internal and external audits by providing required data, explanations, and supporting schedules. Prepare reconciliation metrics, KPIs, and management summaries to support governance and decision making. Process Maturity Continuous Improvement Support Process Maturity Model (PMM) initiatives as directed by the Team Lead or Manager. Execute assigned process improvement actions and support implementation of standard operating procedures (SOPs). Identify process gaps, recurring reconciliation issues, and bottlenecks, and recommend practical improvements. Participate in continuous improvement and system enhancement initiatives related to intercompany accounting, reconciliation, netting, and reporting. Contributes to automation, standardization, and simplification of reconciliation and settlement activities to reduce manual effort and cycle time. Assist in maintaining and updating process documentation, work instructions, SOPs, and knowledge repositories. Support data collection and preparation of metrics required for governance reviews and process maturity assessments. Share process knowledge and best practices to promote consistency and standardization across regions. Proactively escalate unresolved discrepancies, risks, or inefficiencies to the Team Lead/Manager. Participate in cross functional and system training to strengthen understanding of end to end intercompany processes and business impact. Skills Competencies: Strong attention to detail and accuracy in financial data management. Strong understanding of Intercompany Accounting, Balance Sheet Reconciliations, and Financial Close processes Experience with ERP systems such as Oracle Fusion, SAP or similar financial systems. Ability to work well in a team environment while also being able to handle individual tasks effectively. Proficiency with MS Office, particularly Excel for data analysis and reporting Ability to analyse large datasets and identify root causes of reconciliation differences. Effective communication and problem-solving skills to manage customer inquiries and resolve issues professionally. Good verbal and written communication skills. Ability to work in a fast-paced, dynamic environment with multiple priorities. Ability to maintain confidentiality and handle sensitive information. Education, Qualifications Experience Bachelor s degree in accounting, Finance, or related field. 3-5 years of experience in Inter Company Reconciliation for Global operation or a related field. Knowledge of accounting principles. Familiarity with accounting software and systems (e. g. Oracle). Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Finance & Accounting - Other Industry Type: Courier / Logistics Department: Finance & Accounting Employment Type: Full Time, Permanent Role Category: Finance & Accounting - Other Education UG: Any Graduate PG: Any Postgraduate Key Skills Finance ManagerERPData analysisSAPOracleMS OfficeFreight forwardingBalance SheetAuditingLogistics

Job description The Apex Group was established in Bermuda in 2003 and is now one of the world s largest fund administration and middle office solutions providers. Our business is unique in its ability to reach globally, service locally and provide cross-jurisdictional services. With our clients at the heart of everything we do, our hard-working team has successfully delivered on an unprecedented growth and transformation journey, and we are now represented by over circa 13,000 employees across 112 offices worldwide.Your career with us should reflect your energy and passion. That s why, at Apex Group, we will do more than simply empower you. We will work to supercharge your unique skills and experience. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. read more Key Skills CVSTalent acquisitionFund administrationApexRecruitment

Job description Technology Innovation Specialist LOCATION : Hyderabad Telangana, India JOB TYPE :FULL TIME Role Purpose A leading Multinational Bank is transforming its Security function into a product-driven, technology-enabled capability. This role is designed for a product-minded innovator who can identify high-impact problems, rapidly prototype solutions, and scale them across a large enterprise.The Innovation Specialist will operate like a Product Manager within a Security organisation, focusing on automation, AI-driven insights, and platform thinking while working closely with security, engineering, and business stakeholder Our ambition: Enable C-suites to act faster, smarter, and with absolute confidence driving rapid digital transformation in risk management. Key Responsibilities Product Ownership Innovation Own the end-to-end lifecycle of internal products and platforms used by security and risk teams Identify inefficiencies and translate them into clear product problem statements and roadmap Define measurable outcomes such as productivity gains, cost reduction, and decision-quality improvement Automation Solution Prototyping Build proof-of-concepts and MVPs using Python for automation, data processing, and integrations Design workflow automations that reduce manual effort across large operational teams Integrate with enterprise systems, APIs, and data sources Stakeholder Collaboration Act as a bridge between business users, security teams, and engineering Work with senior stakeholders to prioritise initiatives based on impact and feasibility Partner with internal platform teams and external vendors to evaluate emerging technologies Core Experience (Updated) 6 10 years of experience in Data Engineering, Platform Engineering, Automation, Product Management or Innovation roles Background in technology-led problem solving within large, complex organisations Prior exposure to risk, compliance, security, or regulated environments is beneficial but not mandatory Use of AI in all of the above Technical Functional SkillsTechnical Skills Hands-on Python and SQL experience for scripting, automation, data manipulation, and API integrations Experience working with enterprise systems, cloud platforms, or internal tooling ecosystems Comfort with modern development practices and iterative delivery AI Prompt Engineering Practical experience working with LLMs and GenAI platforms Strong prompt engineering skills, including: Structured and multi-step prompting Prompt optimisation for consistency and accuracy Techniques to validate and control AI outputs Ability to translate AI capabilities into real business value Product Mindset Strong product thinking: user empathy, prioritisation, and outcome-focused execution Ability to operate in ambiguous problem spaces and convert ideas into shipped solutions Excellent communication and stakeholder management skills Education Bachelor's or Master's degree in Engineering, Computer Science, Data Science, or a related field Graduation from a reputed institute (IITs, NITs, IISc, IIITs, top global universities, or equivalent premier institutions) is strongly preferred Preferred Strong experience building or owning internal enterprise products or platforms Design, test, and optimise prompts for LLM-based enterprise use cases Develop AI-assisted tools such as: Decision-support copilot Intelligent summarisation and insights generation Workflow orchestration using GenAI Establish prompt standards, evaluation methods, and usage guardrails Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Advisor / Consultant Industry Type: Management Consulting Department: Human Resources Employment Type: Full Time, Permanent Role Category: HR Business Advisory Education UG: Any Graduate PG: Any Postgraduate Key Skills pythonmanagement skillsdata processingproblem solvingengineeringdata engineeringsqlscriptingproduct managementcomputer sciencestakeholder managementcomplianceintegrationprocessingapitechnical skillscommunication skillsarchitecture

Job description We are looking for a highly skilled and experienced Placement Specialist to join our team at FutureNse Technologies Private Limited. The ideal candidate should have experience in placement and hiring for client companies in the AI, ML, Data Science domain. Roles and Responsibility Develop and implement effective recruitment strategies to attract top talent. Build and maintain strong relationships with clients and candidates in the AI, ML, Data Science domain. Conduct thorough interviews and assessments to ensure the best fit for each role. Collaborate with internal teams to understand hiring needs and develop targeted recruitment plans. Manage job postings, resumes, and other recruitment materials efficiently. Analyze recruitment metrics to identify areas for improvement and optimize processes accordingly. Job Requirements Proven experience in placement and hiring for client companies in the AI, ML, Data Science domain. Strong understanding of the recruitment process and industry trends. Excellent communication, negotiation, and interpersonal skills. Ability to work independently and as part of a team. Strong analytical and problem-solving skills. Familiarity with recruitment software and tools is an advantage. About Company FutureNse Technologies Private Limited is a leading company in the AI, ML, Data Science domain, committed to delivering innovative solutions and services to its clients. We are a dynamic and fast-paced environment, offering opportunities for growth and development to our employees. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Placement / Alumni Officer Industry Type: Education / Training Department: Teaching & Training Employment Type: Full Time, Permanent Role Category: University Level Educator Education UG: Any Graduate PG: Any Postgraduate Key Skills staphysical designscreeningsoftwarehiringprimetimelvshrsdtiming analysisfloorplansourcingphysical verificationtalent acquisitionfloor planningtiming closuredrcrecruitmentpnrnegotiationplacementtclcommunication skills

Job description Role & responsibilities We are seeking an experienced IT Administrator to manage and maintain our computer systems, networks, and infrastructure. The successful candidate will ensure the smooth operation of our IT systems, provide technical support to employees, and implement new technologies to improve efficiency. 1. System Administration: Manage and maintain computer systems, servers, and networks. 2. Technical Support: Provide technical support to employees, resolving hardware and software issues. 3. Network Administration: Configure and manage network devices, ensuring optimal performance and security. 4. Security: Implement and maintain security measures to protect against cyber threats. 5. Data Backup and Recovery: Develop and implement data backup and recovery procedures. 6. IT Projects: Assist in planning and implementing new IT projects and technologies. 7. Troubleshooting: Troubleshoot hardware and software issues, resolving problems efficiently. 8. Documentation: Maintain accurate documentation of IT systems, processes, and procedures. PREFERED RESIDING WESTERNLINE CANDIDATE hr@arikaholidays.com MS.SARIKA - 9920180304 Role: IT Operations Management Industry Type: Travel & Tourism Department: IT & Information Security Employment Type: Full Time, Permanent Role Category: IT Infrastructure Services Education UG: Graduation Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills System Administration Technical SupportNetwork AdministrationNetwork TroubleshootingTroubleshootingData Backup