Job description Overview of Job Function: The Product Support Engineer role analyzes and evaluates technical problems and/or functionality questions within the software based on the application, data source or integration with external applications. The role determines the best course of action to resolve the problem or inquiry. Minimum Requirements: 3+ years of customer contact center or customer service experience that supports implementation, and troubleshooting of software applications and related technology infrastructure, or equivalent Demonstrate a continuous passion for learning and growing technical skills Experience with operating systems, desktop domains (active directory) and Windows security Ability to interpret schemas and/or author queries and stored procedures Strong written and verbal communication skills Experience in documenting customer issues with ability to tailor the explanation of technical concepts to the audience Experience in effectively dealing with internal escalations from Verint Professional Services and customer Familiarity with Contact Center operations and technology software and tools Ability to work a flexible schedule in the interest of customer satisfaction; may be required to participate in on-call rotations consistent with Support s on-call practice Customers may request that additional checks be conducted on Verint employees. Verint reserves the right, consistent with applicable law, to require employees in certain positions to undergo background checks periodically or as needed based on our customer s requirements. Preferred Requirements: Bachelor s degree in a technology discipline or related field Familiarity with use of troubleshooting and diagnostic tools such as Wireshark, NetMon, PerfMon, WinDBG, etc. Familiarity with WEB Server Technology (i.e. IIS, WebLogic, Tomcat, Apache) Prior experience with the installation, support, usage or administration of Workforce Management related products or Verint software Understanding of networking and protocols (TCP/IP, SMTP, etc.) Knowledge of telecom systems (CTI, PBX, VOIP) including switches and protocols Familiarity with Information Security (i.e. SSL/PKI, Security hardening, Firewall) Demonstrated experience working with databases (SQL preferred) Ability to interpret schemas and/or author simple queries and stored procedures Ability to author technical articles to document found solution Principal Duties and Essential Responsibilities: Assist Verint Professional Services customer with assigned technical support issues that are reported via telephone, web and email. Provide accurate analysis, troubleshooting and testing of technical issues. Ensure the highest level of communication with the customer to meet Verint s contractual Service level Agreement (SLA) by providing regular updates with respect to progress of each incident, and quickly providing high quality, complete, and timely solutions in a professional manner while demonstrating the highest level of customer service. Facilitate resolutions with Verint s customer contacts and with other members of the Verint organization (sales, services, product house, etc.) as necessary during problem resolution. Technical guidance may be provided by a Senior Product Support Engineer and/or Technical Lead. Follow and maintain all standards for tracking and documenting issues throughout the lifecycle of a support case. Meet or exceed customer satisfaction objectives. Develop knowledge base articles as part of the case management workflow. Demonstrate a complete understanding of the features and functions of assigned products. Develop and maintain product knowledge relevant to product offerings, current support policies and methods of support delivery in order to quickly provide technically accurate and complete resolutions. Deliver internal training on their area of expertise to other members of the team, as necessary. Other duties and responsibilities as assigned. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: System Administrator / Engineer Industry Type: IT Services & Consulting Department: Engineering - Hardware & Networks Employment Type: Full Time, Permanent Role Category: IT Network Education UG: Any Graduate PG: Any Postgraduate Key Skills TelecomNetworkingWorkflowCustomer serviceWindowsTroubleshootingPrincipalTechnical supportProduct supportSQL
Posted 2 hours ago
•
Typically responds within 2 days
Job description About the Role We are looking for an experienced Mobile Product Support Engineer to join our Global Technical Support organization. This role is ideal for a technical leader who thrives on solving highly complex mobile-related issues, with a strong focus on customer impact, operational workflows, and regulatory considerations. As a Product Support Engineer, Mobile Experience, you will serve as a senior technical escalation owner responsible for leading complex investigations end-to-end across Samsara s mobile ecosystem. You will work cross-functionally with Engineering and Product teams to drive issue resolution, improve product quality, and influence roadmap decisions that enhance the reliability, compliance, and supportability of Samsara s mobile applications. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. read more Key Skills Data analysisDebuggingTroubleshootingJIRATechnical supportMonitoringProduct supportSQLAndroidPython
Posted 5 hours ago
•
Typically responds within 2 days
Job description About DP World Trade is the lifeblood of the global economy, creating opportunities and improving the quality of life for people around the world. DP World exists to make the world s trade flow better, changing what s possible for the customers and communities we serve globally. With a dedicated, diverse and professional team of more than 111, 000 employees from 159 nationalities, spanning 77 countries on six continents, DP World is pushing trade further and faster towards a seamless supply chain that s fit for the future. We re rapidly transforming and integrating our businesses -- Ports and Terminals, Marine Services, Logistics and Technology and uniting our global infrastructure with local expertise to create stronger, more efficient end-to-end supply chain solutions that can change the way the world trades. Whats more, were reshaping the future by investing in innovation. From intelligent delivery systems to automated warehouse stacking, we re at the cutting edge of disruptive technology, pushing the sector towards better ways to trade, minimizing disruptions from the factory floor to the customer s door. About DP World Global Service Centre DP World s Global Service Centre (GSCs) are key enablers of growth delivering standardization, process excellence and expertise, and automation in areas of Finance, Freight Forwarding, Marine Services, Engineering and Human Resources, helping accelerate DP World s growth and business transformation. As we experience exponential growth, there has never been a more exciting time to join us. Discover your next role here and change whats possible for everyone! As an equal employer that recognizes and values diversity and an inclusive culture, we empower and up-skill our people with opportunities to perform at their best. Join us and be part of an amazing team that is transforming the future of world trade. Role Purpose: Global Freight Forwarding Finance is responsible for managing global intercompany reconciliation activities across Freight Forwarding entities and regions. The role ensures accurate reconciliation, timely resolution of differences, effective intercompany netting and settlement, and compliance with group financial controls. The position serves as a key liaison between Group Finance Team, Regional Finance Teams, Global Shared Service (GSC) Team and Freight Forwarding Operations to support accurate financial reporting and efficient working capital management. Designation: Specialist - Forwarding Finance - Global Service Centre Base Location: Navi Mumbai Reporting to: Asst. Manager -Finance-Freight Forwarding Key Role Responsibilities: Global Intercompany Reconciliation Perform monthly reconciliation of intercompany balances and transactions across global Freight Forwarding entities using Oracle/other system reports for GSC supported entities. Perform intercompany reconciliations between GSC supported entities and other intercompany counterparts on a monthly and ad hoc basis. Investigate and resolve intercompany mismatches, unreconciled balances, and aged open items. Coordinate with GSC Finance teams, Regional Finance teams, and intercompany counterparties to ensure timely resolution of reconciling items. Ensure completion of intercompany reconciliations within agreed timelines. Monitor intercompany ageing and drive corrective actions to minimize outstanding balances. Netting Settlement Management Prepare and execute global intercompany netting and settlement processes for Freight Forwarding entities supported by GSC using Oracle or other prevailing systems. Validate balances included in netting cycles and coordinate with participating entities and GSC Freight Forwarding Finance teams. Track settlement status and ensure timely closure of outstanding intercompany positions. Prepare reports and dashboards related to netting participation and settlement performance. Stakeholder Management Partner with Global Freight Forwarding Finance, Regional Controllers, Global Shared Service Centre, and Operations teams. Facilitate regular governance discussions to review reconciliation status and aged balances. Provide timely updates and escalate critical issues impacting financial close or settlements. Build strong working relationships with GSC teams and global stakeholders to drive issue resolution and ensure process compliance. Controls, Compliance Reporting Ensure compliance with company accounting policies, internal controls, and financial governance requirements. Maintain complete reconciliation documentation with audit ready supporting evidence. Support internal and external audits by providing required data, explanations, and supporting schedules. Prepare reconciliation metrics, KPIs, and management summaries to support governance and decision making. Process Maturity Continuous Improvement Support Process Maturity Model (PMM) initiatives as directed by the Team Lead or Manager. Execute assigned process improvement actions and support implementation of standard operating procedures (SOPs). Identify process gaps, recurring reconciliation issues, and bottlenecks, and recommend practical improvements. Participate in continuous improvement and system enhancement initiatives related to intercompany accounting, reconciliation, netting, and reporting. Contributes to automation, standardization, and simplification of reconciliation and settlement activities to reduce manual effort and cycle time. Assist in maintaining and updating process documentation, work instructions, SOPs, and knowledge repositories. Support data collection and preparation of metrics required for governance reviews and process maturity assessments. Share process knowledge and best practices to promote consistency and standardization across regions. Proactively escalate unresolved discrepancies, risks, or inefficiencies to the Team Lead/Manager. Participate in cross functional and system training to strengthen understanding of end to end intercompany processes and business impact. Skills Competencies: Strong attention to detail and accuracy in financial data management. Strong understanding of Intercompany Accounting, Balance Sheet Reconciliations, and Financial Close processes Experience with ERP systems such as Oracle Fusion, SAP or similar financial systems. Ability to work well in a team environment while also being able to handle individual tasks effectively. Proficiency with MS Office, particularly Excel for data analysis and reporting Ability to analyse large datasets and identify root causes of reconciliation differences. Effective communication and problem-solving skills to manage customer inquiries and resolve issues professionally. Good verbal and written communication skills. Ability to work in a fast-paced, dynamic environment with multiple priorities. Ability to maintain confidentiality and handle sensitive information. Education, Qualifications Experience Bachelor s degree in accounting, Finance, or related field. 3-5 years of experience in Inter Company Reconciliation for Global operation or a related field. Knowledge of accounting principles. Familiarity with accounting software and systems (e. g. Oracle). Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Finance & Accounting - Other Industry Type: Courier / Logistics Department: Finance & Accounting Employment Type: Full Time, Permanent Role Category: Finance & Accounting - Other Education UG: Any Graduate PG: Any Postgraduate Key Skills Finance ManagerERPData analysisSAPOracleMS OfficeFreight forwardingBalance SheetAuditingLogistics
Posted 1 day ago
•
Typically responds within 2 days
Job description The Apex Group was established in Bermuda in 2003 and is now one of the world s largest fund administration and middle office solutions providers. Our business is unique in its ability to reach globally, service locally and provide cross-jurisdictional services. With our clients at the heart of everything we do, our hard-working team has successfully delivered on an unprecedented growth and transformation journey, and we are now represented by over circa 13,000 employees across 112 offices worldwide.Your career with us should reflect your energy and passion. That s why, at Apex Group, we will do more than simply empower you. We will work to supercharge your unique skills and experience. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. read more Key Skills CVSTalent acquisitionFund administrationApexRecruitment
Posted 1 day ago
•
Typically responds within 2 days
Job description We are looking for a highly skilled and experienced Placement Specialist to join our team at FutureNse Technologies Private Limited. The ideal candidate should have experience in placement and hiring for client companies in the AI, ML, Data Science domain. Roles and Responsibility Develop and implement effective recruitment strategies to attract top talent. Build and maintain strong relationships with clients and candidates in the AI, ML, Data Science domain. Conduct thorough interviews and assessments to ensure the best fit for each role. Collaborate with internal teams to understand hiring needs and develop targeted recruitment plans. Manage job postings, resumes, and other recruitment materials efficiently. Analyze recruitment metrics to identify areas for improvement and optimize processes accordingly. Job Requirements Proven experience in placement and hiring for client companies in the AI, ML, Data Science domain. Strong understanding of the recruitment process and industry trends. Excellent communication, negotiation, and interpersonal skills. Ability to work independently and as part of a team. Strong analytical and problem-solving skills. Familiarity with recruitment software and tools is an advantage. About Company FutureNse Technologies Private Limited is a leading company in the AI, ML, Data Science domain, committed to delivering innovative solutions and services to its clients. We are a dynamic and fast-paced environment, offering opportunities for growth and development to our employees. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Placement / Alumni Officer Industry Type: Education / Training Department: Teaching & Training Employment Type: Full Time, Permanent Role Category: University Level Educator Education UG: Any Graduate PG: Any Postgraduate Key Skills staphysical designscreeningsoftwarehiringprimetimelvshrsdtiming analysisfloorplansourcingphysical verificationtalent acquisitionfloor planningtiming closuredrcrecruitmentpnrnegotiationplacementtclcommunication skills
Posted 1 day ago
•
Typically responds within 2 days
Job description Role & responsibilities We are seeking an experienced IT Administrator to manage and maintain our computer systems, networks, and infrastructure. The successful candidate will ensure the smooth operation of our IT systems, provide technical support to employees, and implement new technologies to improve efficiency. 1. System Administration: Manage and maintain computer systems, servers, and networks. 2. Technical Support: Provide technical support to employees, resolving hardware and software issues. 3. Network Administration: Configure and manage network devices, ensuring optimal performance and security. 4. Security: Implement and maintain security measures to protect against cyber threats. 5. Data Backup and Recovery: Develop and implement data backup and recovery procedures. 6. IT Projects: Assist in planning and implementing new IT projects and technologies. 7. Troubleshooting: Troubleshoot hardware and software issues, resolving problems efficiently. 8. Documentation: Maintain accurate documentation of IT systems, processes, and procedures. PREFERED RESIDING WESTERNLINE CANDIDATE hr@arikaholidays.com MS.SARIKA - 9920180304 Role: IT Operations Management Industry Type: Travel & Tourism Department: IT & Information Security Employment Type: Full Time, Permanent Role Category: IT Infrastructure Services Education UG: Graduation Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills System Administration Technical SupportNetwork AdministrationNetwork TroubleshootingTroubleshootingData Backup
Posted 1 day ago
•
Typically responds within 2 days
Job description Position Technical Support Executive (Accounting) About JiBe JiBe is a cloud based fully integrated ERP system designed for the Maritime industry. Our goal is to allow commercial ship operators to improve productivity, efficiency and safety levels, while reducing costs. JiBe ERP enables increased automation and streamlining of processes, creating pre-defined work flows and reducing the usage of email and paper. Job Responsibilities Provide application support to end users of our Marine ERP product mainly on Accounting Module and work on quick resolution of issues. Assist new clients through the implementation process and the configuration of the new environment. Troubleshoot application and software related issues and determine the root cause for such issues. Work on defined Service Level Agreements (SLAs) to ensure that our clients receive the best service. Work with development teams throughout the software life cycle ensuring issue resolution and stable software releases. Assist in user training related activities for the JiBe Accounting module. Create help materials documents, help videos, FAQs, and other artifacts for JiBe Accounting module. Qualifications and Skills Any Graduate / B.E. or equivalent with minimum 2+ years of relevant experience. Problem solving skills and ability to priorities tasks effectively. Self-motivated, independent and meticulous with an eye for details. Team player with good interpersonal and communication skills Excellent listening and questioning skills, combined with the ability to interact confidently with clients to establish what the problem is and explain the solution. Basic knowledge of cloud services. Excellent English writing skills with grip on nonverbal (mail) communication Ability to work well as a team player. Strong customer focus Shipping experince in Accounts department will be an added advantage. Role: Finance & Accounting - Other Industry Type: Ports & Shipping Department: Finance & Accounting Employment Type: Full Time, Permanent Role Category: Finance & Accounting - Other Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills AccountingTechnical SupportEnglish Verbal And WrittenTroubleshooting SLA
Posted 1 day ago
•
Typically responds within 2 days
Job description NA Role: Customer Service Industry Type: IT Services & Consulting Department: Customer Success, Service & Operations Employment Type: Full Time, Permanent Role Category: Customer Success, Service & Operations - Other Education UG: B.Tech / B.E. in Any Specialization Key Skills Skills highlighted with ‘‘ are preferred keyskills Cargo Operations Customer SupportTechnical SupportPLSQL
Posted 1 day ago
•
Typically responds within 2 days
Job description Sustainability Tool Implementation (Siemens TcPCM), Carbon footprint, Recycled content, Know-How on Scope 1, 2 and 3 emissions, Water and Waste Management Consulting awarenessCost and Carbon balance Compliance management exposureSustainability Tool Implementatio n (Siemens TcPCM), Carbon footprint, Recycled content, Know-How on Scope 1, 2 and 3 emissions, Water and Waste ManagementConsulting awareness Cost and Carbon balance Compliance management exposure read more Key Skills Skills highlighted with ‘‘ are preferred keyskills Teamcenter Waste ManagementCompliance managementCarbon Footprint
Posted 1 day ago
•
Typically responds within 2 days
Job description Step into a role of an Analyst where you will manage and oversee key finance operations, ensuring compliance and smooth processing of transactions. You may be assessed on key critical skills relevant for success in role such as: Processing of inward /outward including Cross border transactions that are managed by Barclays corporate Operations. This includes all the payment scheme such as IMPS/NEFT/RTGS/NACH. Executive is responsible for the accurate error free and timely processing of day today payment transactions. To process transactions as per specified service level agreements adhering to internal and regulatory guidelines. Desirable skills sets: To perform operational duties in TAT prescribed by the bank with due diligence. Understanding of MS Excel and MS Word. Meticulous, fast learner and able to work with minimum supervision. Able to work independently in a fast-paced working environment. You may be assessed on key critical skills relevant for success in role, such as risk and controls, change and transformation, business acumen, strategic thinking and digital and technology, as well as job-specific technical skills. This role is based in Pune. Purpose of the role To provide resolutions for customer queries/issues and personalise each interaction through the use of multiple communication channels. Accountabilities Collaboration across multiple digital channels to personalise each interaction with a customer. Enhancing the banks digital capabilities when current technology is identified as not yet ready to support. Provision of exceptional customer service to clients by responding to inquiries, resolving issues and handling client requests efficiently. Support the collaboration of internal stakeholders including sales, operational, and risk management teams to meet client needs and expectations, so that transactions are executed accurately and on time. Support teams within the business operations function as needed, including risk management, compliance and collections. Comply with all regulatory requirements and internal policies related to customer care. To provide resolutions for customer queries/issues and personalise each interaction through the use of multiple communication channels. Analyst Expectations To meet the needs of stakeholders/ customers through operational excellence and customer service Perform prescribed activities in a timely manner and to a high standard No people leadership roles at this grade. Execute work requirements as identified in processes and procedures, collaborating with and impacting on the work of team members. Identify escalation of policy breaches as required. Take responsibility for customer service and operational execution tasks. Take ownership for managing risk and strengthening controls in relation to the work you own or contribute to. Deliver your work and areas of responsibility in line with relevant rules, regulation and codes of conduct. Gain and maintain an understanding of own role, how the team integrates to achieve overall objectives, alongside knowledge of the work of other teams within the function. Work within well-defined procedures that may involve a variety of work routines. Demonstrate an understanding of the procedures. Evaluate and select the appropriate alternatives from defined options. Make judgements based on the analysis of factual information. Build relationships with stakeholders and customers to identify and address their needs, in support of a smooth operating process, handling sensitive issues as required. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Insurance Analyst Industry Type: Financial Services Department: BFSI, Investments & Trading Employment Type: Full Time, Permanent Role Category: Life Insurance Education UG: Any Graduate PG: Any Postgraduate Key Skills Due diligenceService levelOperational excellenceSenior AnalystService excellenceRTGSCustomer serviceRisk managementOperationsBusiness operations
Posted 1 day ago
•
Typically responds within 2 days