Search Filters Reset ↺
Experience
Work Mode
Job Type
Industry
Skills
Company
Notice Period
Education
Reset Filters
TrueCV Premium
Upgrade to TrueCV Pro

Get featured application status, direct recruiter chat, and double your callbacks.

Upgrade Now
1507 Jobs Found
Sort by:
GRA
Data Scientist, Integrity Recruiter Active
Grab 4.3
Bengaluru 2-5 Yrs Not disclosed
View Job
Job description Get to Know Our Team The Grab Integrity team is dedicated to protecting the Grab platform from multiple types of fraud and safety incidents. Our team uses rich datasets ranging from payment risk prediction using sequence-based models to detecting money laundering with graph algorithms and ensuring platform safety. We research new methods to stay ahead of latest fraud tactics, contributing to the creation of thoughtful and secure products. Get to Know the Role: Youll fight fraud by analysing transactional data, developing and deploying machine learning models, and collaborating with teams to ensure seamless integration of fraud detection systems. Youll help keep our platform safe and trustworthy. Reporting to the Data Science Manager II, this will be a Full-time role in Bangalore The Critical Tasks You Will Perform: Collaborate with your team to understand and convert operational issues into data science problems, aligning efforts with our strategic goals. Stay updated with the latest research and advancements in the field, incorporating the latest models and techniques to address new fraud tactics. Handle data preparation and augmentation, using multiple data types to create comprehensive datasets for model training. Train and improve machine learning models, ensuring accuracy and efficiency in fraud detection through careful selection and tuning of algorithms. Types of algorithms the team work on include Graph Neural Networks, Transformer/ Sequence models, finetuned LLMs, Boosted Trees Deploy models into production, managing their performance, and working with data scientists, software engineers, and product managers to ensure seamless integration and ongoing improvements. Read more Skills you need The Essential Skills You Will Need: Degree in computer science, physics, statistics, or a related quantitative field. Proficiency in Python, SQL, and programming skills, with familiarity with numeric libraries, containers, and modular software design 2 or more years of experience of standard machine learning libraries such as TensorFlow, PyTorch, XGBoost, LightGBM, and Scikit-learn Understand and some experience using traditional ML techniques like Boosted Trees, and deep neural network architectures, like CNNs, RNNs, Transformers Role: Data Scientist Industry Type: IT Services & Consulting Department: Data Science & Analytics Employment Type: Full Time, Permanent Role Category: Data Science & Machine Learning Education UG: Any Graduate PG: Any Postgraduate Key Skills Computer scienceSoftware designdata scienceNeural networksMachine learningMedical insuranceOperationsFraud detectionSQLPython
Posted 2 hours ago Typically responds within 2 days
ATL
Software Engineer Recruiter Active
Atlasrtx 4.3
Pune 1-3 Yrs Not disclosed
View Job
Job description So, what s the role all about We are looking for a highly driven and technically skilled Software Engineer to lead the integration of various Content Management Systems with AWS Knowledge Hub, enabling advanced Retrieval-Augmented Generation (RAG) search across heterogeneous customer data without requiring data duplication. This role will also be responsible for expanding the scope of Knowledge Hub to support non-traditional knowledge items and enhance customer self-service capabilities. You will work at the intersection of AI, search infrastructure, and developer experience to make enterprise knowledge instantly accessible, actionable, and AI-ready. How will you make an impact Integrate CMS with AWS Knowledge Hub to allow seamless RAG-based search across diverse data types eliminating the need to copy data into Knowledge Hub instances. Extend Knowledge Hub capabilities to ingest and index non-knowledge assets, including structured data, documents, tickets, logs, and other enterprise sources. Build secure, scalable connectors to read directly from customer-maintained indices and data repositories. Enable self-service capabilities for customers to manage content sources using App Flow, Tray. ai, configure ingestion rules, and set up search parameters independently. Collaborate with the NLP/AI team to optimize relevance and performance for RAG search pipelines. Work closely with product and UX teams to design intuitive, powerful experiences around self-service data onboarding and search configuration. Implement data governance, access control, and observability features to ensure enterprise readiness. Have you got what it takes Proven experience with search infrastructure, RAG pipelines, and LLM-based applications. 2+ Years hands-on experience with AWS Knowledge Hub, AppFlow, Tray. ai, or equivalent cloud-based indexing/search platforms. Strong backend development skills (Python, Typescript/NodeJS, . NET/Java) and familiarity with building and consuming REST APIs. Infrastructure as a code (IAAS) service like AWS Cloud formation, CDK knowledge Deep understanding of data ingestion pipelines, index management, and search query optimization. Experience working with unstructured and semi-structured data in real-world enterprise settings. Ability to design for scale, security, and multi-tenant environment. What s in it for you Enjoy NICE-FLEX! Reporting into: Tech Manager, Engineering, CX Role Type: Individual Contributor About NICE Role: Full Stack Developer Industry Type: Software Product Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Any Graduate PG: Any Postgraduate Key Skills Content managementBackendquery optimizationCloudFlexCMSdata governanceInfrastructureAWSPython
Posted 5 hours ago Typically responds within 2 days
INV
Invisia Software 4.3
Bengaluru 6-9 Yrs 8-18 Lacs PA
View Job
Job description Greetings from INVISIA SOFTWARE. We are hiring for Technical Lead/ Senior Software engineer with 6+ years of experience. Skills: node.js, Angular. Location: Kalyan Nagar, Bangalore About the Role: We are seeking a highly skilled and hands-on Technical Lead to oversee both front-end and back-end development teams. This role requires a strong understanding of full-stack development with Node.js and Angular, experience working with Java-based systems, and familiarity with mobile platforms (Android/iOS). Experience in the travel domain and AI/ML technologies would be a strong plus. As a Technical Lead, you will collaborate closely with product managers, designers, and developers to drive the design, development, and delivery of high-quality solutions. Key Responsibilities: •Lead and manage a cross-functional team of front-end and back-end developers. •Provide technical leadership across the full software development lifecycle. •Architect, design, and guide implementation for scalable web and mobile solutions. •Conduct code reviews, enforce best practices, and mentor team members. •Collaborate with stakeholders to translate business requirements into technical solutions. •Drive improvements in engineering processes, tools, and standards. •Stay up-to-date with emerging technologies, especially in mobile, AI/ML, and travel tech. •Oversee the integration of AI/ML tools and components into existing systems when applicable. Technical Skills and Experience: •Front-end: Strong experience with Angular (latest versions preferred). •Back-end: Expertise in Node.js (Express, NestJS, or related frameworks). •Additional: Working knowledge of Java-based back-end systems (Spring Boot or similar frameworks). •Database: Strong understanding of relational and NoSQL databases. •Cloud: Experience with cloud services (AWS) is a plus. •Travel Tech: Prior experience working on travel domain products (booking systems, travel APIs, etc.) is highly desirable. •AI/ML: Exposure to AI/ML concepts, tools, and integration into applications is an advantage. Required Qualifications: •Bachelors or Master’s degree in Computer Science, Engineering, or a related field. •6-9+ years of overall software development experience. •2+ years leading technical teams. •Proven track record of delivering complex web and mobile applications. •Excellent communication, collaboration, and leadership skills. Preferred Qualifications: •Experience with CI/CD, DevOps practices. •Hands-on experience in microservices architecture. •Mobile: Exposure to mobile application development (Android/iOS) or managing mobile teams. •Familiarity with travel technology standards (e.g., GDS systems, NDC APIs, OTA standards). •Exposure to AI/ML platforms *Interested candidates do share your updated CV to shamala.m@invisiasoftware.com OR Whatsapp 7795066884* Role: Technical Lead Industry Type: Software Product Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills Node.js JavaNodeMongoDBSpring BootAWSAngularMicroservices
Posted 1 day ago Typically responds within 2 days
KEA
Fullstack Software Engineer Recruiter Active
Kearney - HOPTEKAI 4.3
Mysuru 3-6 Yrs Not disclosed
View Job
Job description Full Stack Software Engineer Location- Mysuru (Preferred) or Remote (India) Full-Time | 3+ Years Experience ABOUT KEARNEY: Kearney is a leading global management consulting firm with more than 5,300 people working in more than 40 countries. We work with more than three-quarters of the Fortune Global 500, as well as with the most influential governmental and nonprofit organizations. read more Key Skills Skills highlighted with ‘‘ are preferred keyskills Node.JsCloud PlatformReact.JsAWSSQL Backend service architectureAzure CloudGCPRest API
Posted 1 day ago Typically responds within 2 days
NUT
Member of Technical Staff Recruiter Active
Nutanix 4.3
Pune, Bengaluru 7-14 Yrs Not disclosed
View Job
Job description The Opportunity Nutanix is looking for a Software Engineer in Test to be a part of the Files team based in India. Files Storage provides a scale-out distributed file storage solution supporting SMB and NFS on top of Nutanix AOS. Virtual file server controllers are deployed across nodes within an existing cluster, or on a dedicated file storage cluster. Nodes are designed to be self-contained and share nothing, eliminating single points of failure. File Storage architecture scales out easily by adding virtual resources and can be deployed across a variety of environments, including data-centres, remote and branch offices, edge locations, and clouds. We seek individuals who possess vibrant energy, robust technical expertise, and proficient Python programming skills. At Nutanix, we embrace visionary minds those who fearlessly tackle daunting tasks and are eager to expand their knowledge. About the Team At Nutanix, youll be joining the Nutanix Files QA team, which is a diverse group of professionals spread across India and the US. Our team culture is strongly rooted in innovation, fostering an environment where every member is encouraged to think outside the box and contribute new ideas. We pride ourselves on collaboration and support, making it a great place for team members to grow and develop their skills. You will report to the Director of Engineering, who is committed to empowering the team and enhancing our collaborative spirit. The work setup is hybrid, allowing flexibility 2-3 days a week in the office to facilitate in-person interactions and teamwork. Your Role Execute test cases as part of new feature testing, and enable automated regression runs for subsequent releases. Working closely with the Development team to ensure the feature is easy-to-use and debuggable. Actively participate in requirements, functional / integration and design aspects of new features & enhancements. Writing test plans and approaches that suit customer deployments and coming up with detailed test plans for the functionality would be an added advantage. What You Will Bring Experience with writing and debugging test plans / failures for complex enterprise software. Experience with troubleshooting and debugging in Linux or Windows environments. Bachelors in Computer Science or related field with 7-14 years of experience. Prior to Experience with NFS and SMB protocols. Prior to experience on Cloud Platforms, AWS / Azure will be an added advantage. Nice to have Familiar with Data Centre technologies (Storage NAS/HCI, Networking, Virtualisation) Experience with Microsoft technologies such as Active Directory and DNS . Familiar with Distributed System concepts, HA, Clustered environments. Experience working in the Cloud Good programming skills and experience in Python. -- Nutanix is an Equal Employment Opportunity and (in the U. S. ) an Affirmative Action employer. Qualified applicants are considered for employment opportunities without regard to race, color, religion, sex, sexual orientation, gender identity or expression, national origin, age, marital status, protected veteran status, disability status or any other category protected by applicable law. We hire and promote individuals solely on the basis of qualifications for the job to be filled. We strive to foster an inclusive working environment that enables all our Nutants to be themselves and to do great work in a safe and welcoming environment, free of unlawful discrimination, intimidation or harassment. As part of this commitment, we will ensure that persons with disabilities are provided reasonable accommodations. If you need a reasonable accommodation, please let us know by contacting [email protected] . Role: Blockchain Quality Assurance Engineer Industry Type: Software Product Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Quality Assurance and Testing Education UG: B.Sc in Chemistry PG: Any Postgraduate Key Skills Computer scienceAutomationLinuxNetworkingDebuggingActive directoryDNSWindowsTroubleshootingPython
Posted 1 day ago Typically responds within 2 days
ASV
Software Engineer Recruiter Active
ASV Consulting Services 4.3
Bengaluru 5-9 Yrs 9-13 Lacs PA
View Job
Job description Job Title: Software Engineer (Contractual) Location: Bengaluru (Work From Office) Experience: 5 – 6 Years Salary: 9 LPA – 13 LPA Employment Type: Contractual (1 Year + Extendable) Client: MicroGenesis On Payroll of: Nyxtech Hiring Contact: Yash Sharma (LinkedIn: linkedin.com/in/yashsharma1608) Notice Period: Immediate to 15 Days Job Description: We are looking for a skilled Software Engineer with expertise in GitLab administration, AWS infrastructure management with Terraform, containerization technologies, and monitoring tools to join our client MicroGenesis on a contractual basis. The role requires hands-on experience with cloud infrastructure, DevOps tools, and Linux environments. Responsibilities: Manage and administer GitLab for CI/CD pipelines and repository management. Design and implement AWS infrastructure using Terraform. Manage Linux-based environments and troubleshoot system issues. Containerize applications using Docker and orchestrate using Kubernetes. Monitor system health and application performance with Prometheus, Grafana, and CloudWatch. Collaborate with development and operations teams to streamline deployment and monitoring processes. Required Skills & Experience: 5 to 6 years of relevant experience in software engineering or DevOps roles. Strong experience with GitLab administration. Proficient with AWS and infrastructure-as-code using Terraform. Solid Linux knowledge and troubleshooting skills. Hands-on experience with Docker and Kubernetes. Familiarity with monitoring tools such as Prometheus, Grafana, and CloudWatch. Ability to work onsite in Bengaluru. Immediate to 15 days notice period preferred. Contract Details: Initial contract for 1 year, extendable based on performance and business needs. Candidate will be on payroll of Nyxtech, working with client MicroGenesis. Role: DevOps Consultant / Architect Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Temporary/Contractual Role Category: DevOps Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills Gitlab adminTerraformDockerAWSKubernetes Cloud TrailLinuxCloudPrometheusAmazon CloudwatchGrafanaPython
Posted 1 day ago Typically responds within 2 days
VAY
Embedded AI Engineer Recruiter Active
Vayuz Technologies 4.3
Bengaluru 3-6 Yrs Not disclosed
View Job
Job description Role Expectations : - Develop, optimize, and deploy embedded machine learning models. - Ensure performance, memory optimization, and energy efficiency of AI solutions. - Integrate ML algorithms with embedded controllers and edge computing platforms. - Collaborate closely with automation and software engineers to translate AI solutions into production-grade embedded systems. Qualifications : - Degree in Computer Science, Electrical Engineering, or related field. - Strong proficiency in Python, C/C++, and embedded programming. - Experience with embedded ML frameworks (e.g., TensorFlow Lite, ONNX, Edge Impulse). - Understanding of real-time embedded systems and microcontroller architectures. - Minimum of 2 years of relevant experience with Embedded Systems and AI/ML Role: Post Silicon Test Engineer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Quality Assurance and Testing Education UG: Any Graduate PG: Any Postgraduate Doctorate: Doctorate Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills Embedded System Embedded C++Embedded CMicrocontrollerArtificial IntelligenceMachine LearningPython
Posted 1 day ago Typically responds within 2 days
SYS
Sysvine Technologies 4.3
Chennai 6-11 Yrs Not disclosed
View Job
Job description We’re looking for senior Java developers to create functional software solutions for our FinTech SaaS platform. You’ll understand client requirements, assess current systems, propose designs, and develop solutions for Australian & European clients. Required Candidate profile 6+ years of experience in Java, Spring Boot, and RESTful Web Services Hands-on experience in Microservices and any Database Knowledge of Unit testing, AWS, Docker Interest in learning in frontend Perks and benefits https://tinyurl.com/3mzausth Role: Back End Developer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills JavaRestful WebSpring Boot Unit TestingRDBMSMicroservices
Posted 1 day ago Typically responds within 2 days
INF
Infrascale Inc. 4.3
Chennai 3-5 Yrs Not disclosed
View Job
Job description Job Description We are seeking a highly skilled and experienced Senior Software Engineer specializing in .Net Technologies to join our dynamic team at Infrascale. The ideal candidate will be responsible for designing, developing, and maintaining software solutions, ensuring high performance and responsiveness to requests from the front-end. As a Senior Software Engineer, you will play a crucial role in the architecture and implementation of innovative solutions that meet our business needs. Responsibilities Software Development: Develop high-quality software solutions, adhering to coding standards, best practices, and SOLID principles. System Design: Participate in the design and architecture discussions, providing insights and suggestions for scalable and efficient system design. Feature Implementation: Implement new features and functionalities, ensuring they meet the requirements and are delivered within the specified timelines. Troubleshooting: Investigate and troubleshoot issues reported in production environments, providing timely resolutions to minimize downtime. Code Review: Conduct and participate in code reviews, offering constructive feedback to ensure code quality and maintainability. Collaboration: Collaborate with cross-functional teams including product managers, designers, and other developers to deliver comprehensive solutions. Documentation: Document code, processes, and procedures to facilitate knowledge sharing and maintain system integrity. Continuous Improvement: Stay updated with the latest industry trends, technologies, and best practices, and proactively suggest improvements to enhance system performance and efficiency. Requirements Bachelors Degree: Bachelors degree in Computer Science, Software Engineering, or a related field. Experience: 3-5 years of professional experience, with a strong understanding of object-oriented programming principles. NET Technologies: Experience with .NET web development, building REST web services; .NET desktop application, NUnit and Windows Service development. We use a combination of .NET Framework, Core, and Standard. Experience with ASP.NET Web Services, MVC and WCF is a plus. DBS Technologies: Experience with MS SQL, PostgreSQL, and Entity Framework Core. T-SQL is a plus. Web Technologies: Experience with HTML, CSS, JavaScript, JQuery and related Microsoft stack technologies. Version Control: Proficiency with version control systems, preferably Git, and experience with branching strategies and pull request workflows. Problem-Solving: Strong analytical and problem-solving skills with the ability to debug and troubleshoot complex issues efficiently. Agile & DevOps : Familiarity with Agile development methodologies and DevOps Preferred Qualifications: Storage : Previous experience working with or implementing storage technologies like Microsoft VSCS, or similar proprietary technologies. Experience with MS Graph API and SharePoint API is a plus. Continuous Integration/Continuous Deployment (CI/CD): Experience with CI/CD pipelines using tools like TeamCity, Jenkins, SonarQube. Cloud Platforms: Knowledge of cloud platforms such as especially Google Cloud Platform and Azure, and experience architecting for and deploying applications on these platforms is desirable. Role: Blockchain Quality Assurance Engineer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Quality Assurance and Testing Education UG: Any Graduate PG: Any Postgraduate Key Skills continuous integrationcssci/cdjquerysqlgitpostgresqlgcpdevopsjenkinsteamcityhtmlmvcwcfrestcdsoftware developmententity frameworkversion controlmicrosoft azurejavascriptsql servernunitagilegraph apiaspnet web services
Posted 1 day ago Typically responds within 2 days
UBS
Dynamics 365 Engineer Recruiter Active
UBS India 4.3
Pune 10-15 Yrs Not disclosed
View Job
Job description As a Senior D365 Engineer, you will work in one of the largest and most complex CRM applications buildings. You will work closely with Product Management, Software - Development, Data Engineering and other teams to develop scalable and innovative CRM solutions. develop and customize microsoft dynamics 365 applications to fulfill specific business needs. hands-on experience with crm, sales and marketing modules develop software and design solutions independently to satisfy customer requirements that consider performance and availability partner with engineering product managers and principal software engineers to translate requirements into detailed designs Are you an enthusiastic technology professional? Are you excited about seeking an enriching career, working for one of finest financial institutions in world? If so, you are the right person for this role. We are seeking technology and domain experts to join our Dynamics D365 CRM development team. We are responsible for WMA (Wealth Management Americas) clients facing technology applications. You ll be working in the WMA CRM crew focusing on building applications which are used by financial advisors. Our team is dedicated to creating innovative solutions that drive our organizations success. We foster a collaborative and supportive environment, where you can grow and excel in your role. 10+ years of hands-on experience in software development, specifically with Microsoft Dynamics 365 experience in user management, role assignment, and security configuration within dynamics 365 and power platform ability to configure and customize dynamics 365 applications to meet business requirements, including creating custom entities, workflows, power automate flows and business rules familiarity with azure active directory and integration with other microsoft services proficient in c#, .net, javascript, and sql with experience in web services (rest/soap) solid understanding of dynamics 365 customization, configuration, and deployment using managed solutions experience with the power platform, including power apps (both model-driven and canvas apps), power automate, and pcf controls etc. knowledge of azure and cloud-based services is advantageous, specifically azure functions Role: Head - Engineering Industry Type: BPM / BPO Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Any Graduate PG: Any Postgraduate Key Skills Product managementWeb servicesWealth managementJavascriptActive directorybusiness rulesMicrosoft DynamicsCRM salesUser managementSQL
Posted 1 day ago Typically responds within 2 days
Featured Companies View All
MS
Microsoft
Hiring 84 Jobs
GG
Google
Hiring 52 Jobs
AZ
Amazon
Hiring 67 Jobs
TC
TCS
Hiring 120 Jobs
IN
Infosys
Hiring 61 Jobs
Recommended Courses View All
Java Interview Mastery
4.8 (2.3K) • ₹499
ATS Resume Writing
4.7 (1.8K) • ₹399
LinkedIn Makeover
4.6 (951) • ₹299
HR Interview Course
4.7 (1.2K) • ₹499
Complete ATS Resume
4.8 (2.1K) • ₹499
Get Android App