Job description Skill required: Talent Acquisition - Onboarding Designation: HR Service Delivery Associate Qualifications:Any Graduation Years of Experience:1 to 3 years About AccentureAccenture is a global professional services company with leading capabilities in digital, cloud and security.Combining unmatched experience and specialized skills across more than 40 industries, we offer Strategy and Consulting, Technology and Operations services, and Accenture Song all powered by the worlds largest network of Advanced Technology and Intelligent Operations centers. Our 699,000 people deliver on the promise of technology and human ingenuity every day, serving clients in more than 120 countries. We embrace the power of change to create value and shared success for our clients, people, shareholders, partners and communities.Visit us at www.accenture.com What would you do The Workforce Administration Associate will process incoming requests received through emails or any other application. These requests include resolving and/or completing service requests and working collaboratively with the team members, other internal teams, Third Party vendors or Client.Candidates with End to End Recruitment experience - Domestic/International MarketAdminister onboarding of new employees including all onboarding activities like orientation registration, completion of background check, creation of SAP record, etc. What are we looking for Education Equivalent Bachelor or GraduateExperience1 - 2 yrs. business experience with similar backgroundKnowledge of MS Office and Excel skills would be a plusGood organizational & prioritisation skills.Analytical and problem solving skills.Multi-cultural awareness.Passion for customer service.Team player. Results & detail-orientedFocus on high data accuracy.Quality driven in communications and all system transactions.Strong written and verbal skills in English Language. Roles and Responsibilities: The Workforce Administration Associate will process incoming requests received through emails or any other application. These requests include resolving and/or completing service requests and working collaboratively with the team members, other internal teams, Third Party vendors or Client.Key ResponsibilitiesRead, understand and analyze client process as per the business rules.Execute the process accurately and timely as a hands-on processor.Escalate issues and seek advice when faced with complex issues/problems.Participate in client conference calls and prepare minutes of meeting. Ensure LWIs are followed and updated regularly and train the team members on process updates.Perform Root Cause Analysis on issues faces and suggest appropriate corrective action for current remediation and future control. Must be able to propose process improvement ideas which can reduce time, improved accuracy or enhance controls Must have clear understanding of the existing matrices in the process, how they are measured and improvise the measurement system to make it more effective and transparent. Update process metrics on daily basis and maintain MIS.Always demonstrate the highest level of customer service.Pay close attention to detail and follow through to resolve any outstanding issues.Goes beyond immediate requests and activities to ensure both own and related tasks are completed.Ensure and maintain the security and confidentiality of client data.Update client applications accurately and quickly in accordance with the appropriate User Guides.Understand & perform the full range of Workforce Administration processes (Employee Life cycle) which includes, onboarding the candidate, people movement & benefits administration Must have clear understanding of the existing performance metrics in the process, how they are measured and improvise the measurement system to make it more effective and transparentFollow LWIs while processing & highlight any anomalies in LWIs/process documentation to the SME/Leads.Must be able to propose process improvement ideas which can reduce time, improved accuracy or enha
Posted 2 hours ago
•
Typically responds within 2 days
Job description Plan, execute and track new and existing customers Cloud Savings Program across AWS and/or Azure. Lead discussions and manage customer’s commitment based discounts across all savings instruments. Analyze customer business objectives and use the Apptio Cloudability platform to build insightful reporting, dashboards and savings program Perform analysis and present regular operational reviews to customer & Apptio leadership Collaborate with an internal global team to grow a strategically important part of the Apptio business Partner with other Apptio domain experts to bring together the collective suite of Apptio products to generate insights across customers total IT spend Be the voice of the customer, champion and advocate for customer requirements with our Product and Engineering teams. Required education Bachelor's Degree Preferred education Bachelor's Degree Required technical and professional expertise Overall, 5+ years of industry experience. Hands-on experience with a cloud vendor (AWS or Azure or GCP). Certification in AWS Practitioner or Azure AZ900 Plan, execute and track new and existing customers Cloud Savings Program across CSP's . Deep knowledge of rate optimization at AWS (Savings Plans, Reserved Instances) Track record of increasing FinOps maturity Demonstrated ability to break down complex problems into sub-tasks and track outcomes Experience in customer-facing roles such as consulting, customer success or equivalent experience Lead discussions and manage customer’s commitment based discounts across all savings instruments. Analyze customer business objectives and use the Apptio Cloudability platform to build insightful reporting, dashboards and savings program Perform analysis and present regular operational reviews to customer & Apptio leadership Collaborate with global team to grow a strategically important part of the Apptio business Partner with other Apptio domain experts to bring together the collective suite of Apptio products to generate insights across customers total IT spend Be the voice of the customer, champion and advocate for customer requirements with our Product and Engineering teams Excellent verbal, written and interpersonal communication skills in both technical and non technical contexts Preferred technical and professional experience AWS Certified Solution Architect - Associate or higher (or equivalent knowledge) Role: Customer Success Manager Industry Type: IT Services & Consulting Department: Customer Success, Service & Operations Employment Type: Full Time, Permanent Role Category: Customer Success Education UG: Any Graduate PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills microsoft azurecustomer focusgcpvendoraws project managementpythonrf engineeringteam managementcustomer servicepresentation skillsbusiness developmentstrategic thinkingproblem analysiskey account managementcreativity
Posted 5 hours ago
•
Typically responds within 2 days
Job description As Process Analyst– Record to Report (R2R), you are responsible for general accounting which includes reconciliation, preparation of balance sheet and profit and loss account, fixed assets accounting, inter-company accounting, cash & bank accounting, financial analysis, and reporting. Your primary responsibilities include: Coordinate all accounting activities associated with General Ledger, particularly fixed assets, inter-company, inventory, cash & bank, indirect tax, and accruals. Identify risks or opportunities to revenues, cost, and profitability and propose appropriate actions. Adhere to client Service Level Agreements (SLAs) and meet the specified timelines. Required education Bachelor's Degree Preferred education Master's Degree Required technical and professional expertise Commerce graduate with a minimum of 2-4 years of experience in the Record to Report domain. Experience in preparing Balance sheets, handling Month-End Closure, Fixed Assets, Inter-Company, and Cash reconciliations. Posting Journal entries and recording the transactions in the ERP. Demonstrated proficiency in coordinating audits, meeting customer expectations, and managing updates for management reviews in report management. Preferred technical and professional experience Proficient in MS Office applicationsand any ERP software as an end-user. Self-directed and ambitious achiever. Meeting targets effectively. Skilled in thriving under deadlines and contributing to change management, showcasing strong interpersonal teamwork. Role: Finance Executive Industry Type: IT Services & Consulting Department: Finance & Accounting Employment Type: Full Time, Permanent Role Category: Finance Education UG: Any Graduate PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills financial analysiserpjournal entriesgeneral ledgerrecord to report project managementoperations managementaccounts payableteam managementproblem managementindirect taxationitsmincident managementclosureitilsla management
Posted 1 day ago
•
Typically responds within 2 days
Job description Skill required: Talent Acquisition - Workday Recruiting Designation: Delivery Operations Associate Manager Qualifications:Any Graduation Years of Experience:10 to 14 years About AccentureAccenture is a global professional services company with leading capabilities in digital, cloud and security.Combining unmatched experience and specialized skills across more than 40 industries, we offer Strategy and Consulting, Technology and Operations services, and Accenture Song all powered by the worlds largest network of Advanced Technology and Intelligent Operations centers. Our 699,000 people deliver on the promise of technology and human ingenuity every day, serving clients in more than 120 countries. We embrace the power of change to create value and shared success for our clients, people, shareholders, partners and communities.Visit us at www.accenture.com What would you do Improve workforce performance and productivity, boosts business agility, increases revenue and reduces costsCandidates with End to End Recruitment experience - Domestic/International MarketAn end-to-end talent acquisition application built to help find, share, engage, and select the best internal and external candidates for an organization. What are we looking for . Roles and Responsibilities: In this role you are required to do analysis and solving of moderately complex problems Typically creates new solutions, leveraging and, where needed, adapting existing methods and procedures The person requires understanding of the strategic direction set by senior management as it relates to team goals Primary upward interaction is with direct supervisor or team leads Generally interacts with peers and/or management levels at a client and/or within Accenture The person should require minimal guidance when determining methods and procedures on new assignments Decisions often impact the team in which they reside and occasionally impact other teams Individual would manage medium-small sized teams and/or work efforts (if in an individual contributor role) at a client or within Accenture Please note that this role may require you to work in rotational shifts Qualification Any Graduation Role: Operations Manager Industry Type: IT Services & Consulting Department: Customer Success, Service & Operations Employment Type: Full Time, Permanent Role Category: Operations Education UG: Any Graduate PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills operations managementworkdayservice operationstalent acquisitiondelivery operations project managementlogistics managementwarehouse managementwarehouse operationslogistics operationslogisticssupply chain managementinventory management
Posted 1 day ago
•
Typically responds within 2 days
Job description Skill required: Delivery - Business Insights Designation: I&F Decision Sci Practitioner Manager Qualifications:Any Graduation Years of Experience:13 to 18 years About AccentureAccenture is a global professional services company with leading capabilities in digital, cloud and security.Combining unmatched experience and specialized skills across more than 40 industries, we offer Strategy and Consulting, Technology and Operations services, and Accenture Song all powered by the worlds largest network of Advanced Technology and Intelligent Operations centers. Our 699,000 people deliver on the promise of technology and human ingenuity every day, serving clients in more than 120 countries. We embrace the power of change to create value and shared success for our clients, people, shareholders, partners and communities.Visit us at www.accenture.com What would you do Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills across more than 40 industries, we offer Strategy and Consulting, Song, Technology, Industry X and Operations services all powered by the worlds largest network of Advanced Technology and Intelligent Operations centers. Our 800,000 people deliver on the promise of technology and human ingenuity every day, serving clients in more than 120 countries. We embrace the power of change to create value and shared success for our clients, people, shareholders, partners and communities. Visit us at www.accenture.com.In todays business environment, growth isnt just about building value - it s fundamental to long-term business survival. So how do organizations sustain themselvesThe key is a new operating modelone that s anchored around the customer and propelled by intelligence to deliver outstanding experiences across the enterprise at speed and at scale. You will deliver breakthrough business outcomes for clientsby harnessing talent, data and intelligence to redefine their operating models.Within Operations, our Sales Operations Transformation team is rapidly expanding. We take a bold and modern approach to sales excellencecombining deep operational expertise, cutting-edge technology, and data-driven insights to optimize sales performance and empower go-to-market teams to succeed.The Sales AI/BI & Data Science team is responsible for inspecting, cleansing, transforming, and modeling data with the goal of discovering useful information, suggesting conclusions, and supporting decision-making. Hands on with python programming & understanding of machine learning models. You will have to understand and interpret insights where applied statistics, pattern analysis, forecasting models, predictive analytics or similar methods have been used. What are we looking for Ability to manage multiple workstream and stakeholders. Ability to perform under pressure and agility for quick learning. Ability to establish strong client relationship. Ability to handle disputes. Ability to manage multiple stakeholders and meet deadlines. Strong analytical skills. Working knowledge and experience in building forecasting models. Sales Operations. Microsoft Excel. Sales Reporting & In-depth transformational project experience. Transformation using automation levers and tech of Python, Artificial Intelligence, Machine Learning, Natural Language Processing, and Integration. Good to have exposure to Microsoft Power BI, Power Query and Power Pivot. Roles and Responsibilities: In this role you are required to do analysis and solving of moderately complex problems. May create new solutions, leveraging and, where needed, adapting existing methods and procedures. The person would require understanding of the strategic direction set by senior management as it relates to team goals. Manage the end-to-end project lifecycle, from the inception to fruition and ensure the combined forces of tech and function deliver as expected. May create new solutions, leveraging and, where needed, adapting existing methods an
Posted 1 day ago
•
Typically responds within 2 days
Job description Project Role :Application Developer Project Role Description :Design, build and configure applications to meet business process and application requirements. Must have skills :User Experience (UX) Design Good to have skills :NAMinimum 3 year(s) of experience is required Educational Qualification :15 years full time education Summary:As an Application Developer, you will be responsible for designing, building, and configuring applications to meet business process and application requirements. You will play a crucial role in the development and enhancement of applications to ensure optimal user experience and functionality. Roles & Responsibilities:- Expected to perform independently and become an SME.- Required active participation/contribution in team discussions.- Contribute in providing solutions to work related problems.- Collaborate with cross-functional teams to define, design, and ship new features.- Develop high-quality software design and architecture.- Identify, prioritize, and execute tasks in the software development life cycle.- Conduct software analysis, programming, testing, and debugging.- Create technical documentation for reference and reporting. Professional & Technical Skills: - Must To Have Skills: Proficiency in User Experience (UX) Design.- Strong understanding of user-centered design principles.- Experience with prototyping tools such as Adobe XD or Sketch.- Knowledge of front-end development languages like HTML, CSS, and JavaScript.- Familiarity with usability testing methodologies. Additional Information:- The candidate should have a minimum of 3 years of experience in User Experience (UX) Design.- This position is based at our Bengaluru office.- A 15 years full time education is required. Qualification 15 years full time education Role: Full Stack Developer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: B.Tech/B.E. in Any Specialization PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills cssadobe xdjavascripthtmldesign principles uxsoftware testingsoftware designhibernateapplication developmentspringsketchingsoftware development life cyclespring bootjavasoftware analysisj2eedebuggingtechnical documentation
Posted 1 day ago
•
Typically responds within 2 days
Job description As Process Analyst– Order to Cash (O2C), you are responsible for processing Accounts receivable, posting and balancing daily cash applications, preparing journal entries, filing records, and general account reconciliations. You should be flexible to work in shifts. Your primary responsibilities include: Analysis of receivable accounts, investigation of entries, and pulling audit prep work. Involve in netting instructions, Direct Debit run, rejection of Direct Debit, and Oracle updating. Investigate unapplied payments, rectify them, and ensure proper allocation. Provide information relating to customer payments, refunds, and other miscellaneous accounts receivables questions. Adhere to client Service Level Agreements (SLAs) and meet the specified timelines. Required education Bachelor's Degree Preferred education Master's Degree Required technical and professional expertise Commerce graduate with a minimum of 2-4 years of experience in Order to Cash. Expertise in enhancing cash application automation, increasing touchless cash settlement, and reducing complexity and instability in assigned accounts. Proven track record in meeting accuracy and timeliness goals, achieving individual and business metrics and collaborating with customers, sales, and finance for improvements. Demonstrated hands-on proficiency in enhancing cash application automation, maximizing touchless cash settlement, and minimizing complexity and instability in assigned accounts. Preferred technical and professional experience Proficient in MS Office applicationsand any ERP software as an end-user. Self-directed and ambitious achiever. Meeting targets effectively. Skilled in thriving under deadlines and contributing to change management, showcasing strong interpersonal teamwork. Role: Treasury Operations Manager Industry Type: IT Services & Consulting Department: Finance & Accounting Employment Type: Full Time, Permanent Role Category: Treasury Education UG: Any Graduate PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills accounts receivablelead operationserporder to cashsales accounts payableproject managementoperations managementteam managementteam handlinginvoice processingchange managementprocess managementteam leadingfinancesla management
Posted 1 day ago
•
Typically responds within 2 days
Job description Project Role :Application Lead Project Role Description :Lead the effort to design, build and configure applications, acting as the primary point of contact. Must have skills :SAP FI CO Finance Good to have skills :NAMinimum 7.5 year(s) of experience is required Educational Qualification :15 years full time education Summary:As an Application Lead, you will lead the effort to design, build, and configure applications, acting as the primary point of contact. Your day will involve overseeing the application development process, collaborating with team members, and ensuring project success. Roles & Responsibilities:- Expected to be an SME- Collaborate and manage the team to perform- Responsible for team decisions- Engage with multiple teams and contribute on key decisions- Provide solutions to problems for their immediate team and across multiple teams- Lead the application development process effectively- Ensure timely delivery of projects- Provide guidance and mentorship to team members Professional & Technical Skills: - Must To Have Skills: Proficiency in SAP FI CO Finance- Strong understanding of financial processes and systems- Experience in configuring SAP FI CO modules- Knowledge of financial reporting and analysis- Hands-on experience in leading application development projects Additional Information:- The candidate should have a minimum of 7.5 years of experience in SAP FI CO Finance- This position is based at our Bengaluru office- A 15 years full-time education is required Qualification 15 years full time education Role: Technical Lead Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: B.Tech/B.E. in Any Specialization PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills sapsap fiaccountingapplication developmentsap fico c#accounts receivableaccounts payablefi-gloraclesoftware developmentgeneral ledgersql serversqljavacobolfi-apsap financefi-arasp.netasset accountingfinance
Posted 1 day ago
•
Typically responds within 2 days
Job description Project Role :Application Lead Project Role Description :Lead the effort to design, build and configure applications, acting as the primary point of contact. Must have skills :Oracle Hyperion Financial Management (HFM) Good to have skills :NAMinimum 3 year(s) of experience is required Educational Qualification :15 years full time education Summary:As an Application Lead, you will lead the effort to design, build, and configure applications, acting as the primary point of contact. Your typical day will involve collaborating with various stakeholders to gather requirements, overseeing the development process, and ensuring that the applications meet the specified needs. You will also engage in problem-solving discussions with your team, providing guidance and support to ensure successful project outcomes. Additionally, you will monitor project progress, address any challenges that arise, and facilitate communication among team members to maintain alignment and efficiency in the workflow. Roles & Responsibilities:- Expected to perform independently and become an SME.- Required active participation/contribution in team discussions.- Contribute in providing solutions to work related problems.- Facilitate knowledge sharing sessions to enhance team capabilities.- Develop and maintain comprehensive documentation for applications and processes. Professional & Technical Skills: - Must To Have Skills: Proficiency in Oracle Hyperion Financial Management (HFM).- Strong understanding of financial reporting and analysis.- Experience with application design and configuration.- Familiarity with integration processes and data management.- Ability to troubleshoot and resolve application issues efficiently. Additional Information:- The candidate should have minimum 3 years of experience in Oracle Hyperion Financial Management (HFM).- This position is based at our Bengaluru office.- A 15 years full time education is required. Qualification 15 years full time education Role: Technical Lead Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: B.Tech/B.E. in Any Specialization PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills hyperion financial managementoraclehfmoracle hyperionfinancial reporting financial analysisapplication designhyperion essbaseaccountingbudgetingsqlplsqlsmartviewhyperionjavahyperion planningfinanceunixoracle apps
Posted 1 day ago
•
Typically responds within 2 days
Job description Role Purpose The purpose of the role is to resolve, maintain and manage clients software/ hardware/ network based on the service requests raised from the end-user as per the defined SLAs ensuring client satisfaction Do Ensure timely response of all the tickets raised by the client end user Service requests solutioning by maintaining quality parameters Act as a custodian of clients network/ server/ system/ storage/ platform/ infrastructure and other equipments to keep track of each of their proper functioning and upkeep Keep a check on the number of tickets raised (dial home/ email/ chat/ IMS), ensuring right solutioning as per the defined resolution timeframe Perform root cause analysis of the tickets raised and create an action plan to resolve the problem to ensure right client satisfaction Provide an acceptance and immediate resolution to the high priority tickets/ service Installing and configuring software/ hardware requirements based on service requests 100% adherence to timeliness as per the priority of each issue, to manage client expectations and ensure zero escalations Provide application/ user access as per client requirements and requests to ensure timely solutioning Track all the tickets from acceptance to resolution stage as per the resolution time defined by the customer Maintain timely backup of important data/ logs and management resources to ensure the solution is of acceptable quality to maintain client satisfaction Coordinate with on-site team for complex problem resolution and ensure timely client servicing Review the log which Chat BOTS gather and ensure all the service requests/ issues are resolved in a timely manner Deliver No Performance Parameter Measure 1.100% adherence to SLA/ timelines Multiple cases of red time Zero customer escalation Client appreciation emails Mandatory Skills: Microsoft Dynamics 365 Cloud Admin. Role: System Administrator / Engineer Industry Type: IT Services & Consulting Department: Engineering - Hardware & Networks Employment Type: Full Time, Permanent Role Category: IT Network Education UG: Any Graduate PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills Microsoft Dynamics 365Cloud Admin Chat BOTSAdministration managementactive directoryroot cause analysis
Posted 1 day ago
•
Typically responds within 2 days