Job description Responsibilities: Solution Design & Architecture Design and architect end-to-end solutions on the ServiceNow platform to support various business processes and objectives. Provide architectural guidance and establish best practices to ensure ServiceNow implementations align with enterprise goals. Platform Management & Configuration read more Key Skills AutomationArchitectureData modelingDatabase designCADTechnical leadershipJavascriptAgileHTMLOperations

Job description Dotnet Full Stack Developer Requirements Proven hands-on experience in: Backend: .NET Core, C#, ASP.NET, MVC, Web API, Entity Framework Frontend: JavaScript, React or Angular, HTML, CSS Database: SQL Server, Snowflake (preferred) Tools & DevOps: Git Cloud: AWS Ability to design and implement scalable, secure, and modular applications. Strong understanding of Microservices architecture and RESTful APIs. Experience with database schema design, query optimization, and data integration. Excellent debugging, problem-solving, and performance tuning skills. Strong communication and collaboration skills with at least 5+ years of relevant experience. Bachelor's or Masters in Computer Science, IT, or equivalent discipline Role: Full Stack Developer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills C#.Net CoreAWS CloudReactAngular Web APISql ServerFull StackDevopsSQL

Job description Role: GIS Consultant Location: PAN India Wipro Location(Hybrid, Hyderabad Preferable) Long term Contract To Hire(C2H) Client: (Wipro) Job Description: Mandatory Skillset: SW Magik Development, Upgrade skills to latest version Good to have Skills: GSS, Kubernetes, Web and Mobile platform experience 1. 6+ years of experience in IT projects involving GE Smallworld solution implementation for global customers. At least 2 water utilities implementation experience. 2. Experience and skills in Smallworld 3.3, as well as web development, for SIAS applications. 3. Deep knowledge and experience of application development GE Smallworld CST (Core Spatial Technology), Water Office, Design Manager, Smallworld GeoSpatial Server, Job/Quality Manager, Data Interoperability GSS components. 4. Hands-on development experience and in Solution Design, Technical design, Data model design for Smallworld solution. 5. Experience in legacy GIS Smallworld data extractions would be preferable (with specific experience on FME, data cleansing approach) 6. Experience in Programming languages Magik is mandatory, SQL and Java is desirable. 7. Experience on basic features and functionalities on Databases like Oracle, Maximo and PostgreSQL/SQLite is preferable. 8. Significant client facing experience as GIS Consultant role. Excellent communication and presentation skills. 9. Implement or participate in testing, change management and training plans to ensure the quality of releases and ongoing services Role: Software Development - Other Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Graduation Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills GISSmallworldSW Magik

Job description Senior Java Developer Key Responsibilities: Strong expertise in Java programming, Data analytics, and Java frameworks. This role involves developing robust code for Device DLL communication Design, develop, and maintain Java applications with a focus on device-level integration and DLL communication. Build and package Java-based installers for software deployment and license management Building scalable, high-performance systems and contributing to the full software development lifecycle. Collaborate with cross-functional teams to define, design, and ship new features. Analyze and interpret data to support application logic and performance tuning. Write clean, scalable, and well-documented code following best practices. Troubleshoot and debug applications to optimize performance and reliability. Participate in code reviews and mentor junior developers. Required Skills and Qualifications: Bachelors or master’s degree in computer science, Engineering, or related field. 5+ years of hands-on experience in Java development. Strong understanding of Java classes, OOP principles, and multithreading. Proficiency in Java frameworks such as Spring, Hibernate, or similar. Experience with DLL integration and JNI (Java Native Interface). Familiarity with building installation packages using tools like InstallAnywhere, IzPack, or similar. Solid understanding of data analytics and ability to work with large datasets. Experience with version control systems (e.g., Git) and CI/CD pipelines. Excellent problem-solving skills and attention to detail. Preferred Qualifications: Experience in device communication protocols and embedded systems. Knowledge of licensing frameworks and secure software distribution. Familiarity with Agile/Scrum methodologies Role: Full Stack Developer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills JavaHibernateSpring Boot Spring MvcJNIDLL IntegrationCicd PipelineMicroservicesRobust Communication

Job description We’re looking for senior Java developers to create functional software solutions for our FinTech SaaS platform. You’ll understand client requirements, assess current systems, propose designs, and develop solutions for Australian & European clients. Required Candidate profile 6+ years of experience in Java, Spring Boot, and RESTful Web Services Hands-on experience in Microservices and any Database Knowledge of Unit testing, AWS, Docker Interest in learning in frontend Perks and benefits https://tinyurl.com/3mzausth Role: Back End Developer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills JavaRestful WebSpring Boot Unit TestingRDBMSMicroservices

Job description About the Role : We are seeking an experienced Staff Engineer with a strong background in JavaScript and object-oriented programming (OOP) to lead technical initiatives, mentor junior developers, and drive architectural excellence within our team. The ideal candidate will be responsible for designing new features, reviewing existing architecture, and implementing scalable and efficient solutions in a fast-paced, high-traffic environment. Experience range expected is 12-15 years. Key Responsibilities : - Architect and Solution New Features - Design and develop scalable and maintainable solutions for new product features. - Architectural Review & Refactoring - Evaluate existing system architecture, identify inefficiencies, and implement improvements. - Mentorship & Leadership - Provide guidance to junior developers, fostering growth and best coding practices. - Enforce High Standards - Ensure code quality, maintainability, and performance through best practices, including design patterns, code reviews, and automated testing. - Implement Architecture Patterns - Introduce and refine architectural patterns to enhance scalability, security, and maintainability. - Optimize for Scalability - Build and maintain highly scalable, high-performance systems capable of handling substantial user traffic. - Industry-Specific API Integration - Work with travel-industry-related APIs (such as GDS, airline, hotel, or booking systems) to streamline integrations. - Technology Best Practices - Stay up-to-date with modern technologies, continuously improving the team's technical stack and processes. Qualifications & Experience : - Expertise in JavaScript and a deep understanding of object-oriented programming (OOP) principles. - Proficiency in TypeScript (strongly preferred). - Experience with scalable system design and distributed architectures. - Strong knowledge of software design patterns and best practices. - Previous experience leading architectural discussions and re-architecting systems for efficiency. - Mentorship experience, with a passion for coaching and elevating junior developers. - Understanding of highly scalable, cloud-based systems. - Prior experience with travel-industry-related APIs (e.g, GDS, airline, hotel, or booking systems) is a huge plus. - Familiarity with CI/CD pipelines, DevOps best practices, and cloud platforms (AWS, GCP, or Azure). - Strong communication skills, with the ability to collaborate cross-functionally Role: Head - Engineering Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Any Graduate PG: Any Postgraduate Doctorate: Doctorate Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills JavaScript TypeScriptJavaOOPGDSCI/CD

Job description Job Summary:Were seeking an experienced Testing Automation Engineer to join our QA team. The ideal candidate will design, develop, and maintain automated testing scripts to ensure the quality and reliability of our software applications.Key Responsibilities:1. Design and Develop Automation Frameworks: Create and maintain automated testing frameworks using programming languages such as Java, Python, or C#.2. Automate Test Cases: Develop automated test scripts to cover various testing scenarios, including functional, regression, and integration testing.3. Test Script Maintenance: Maintain and update existing automated test scripts to ensure they remain relevant and effective.4. Collaborate with QA Team: Work closely with the QA team to identify testing requirements and develop automation strategies.5. Integrate Automation with CI/CD: Integrate automated testing with Continuous Integration/Continuous Deployment (CI/CD) pipelines to enable seamless testing.6. Troubleshoot Automation Issues: Identify and resolve issues with automated testing scripts and frameworks.7. Report Automation Results: Provide detailed reports on automated Max_Experience":"5 read more Key Skills continuous integrationAutomationAutomation testingTest scriptsIntegration testingProgrammingTest casesApplication softwarePythonTesting

Job description Job Description We are seeking a highly skilled and experienced Senior Software Engineer specializing in .Net Technologies to join our dynamic team at Infrascale. The ideal candidate will be responsible for designing, developing, and maintaining software solutions, ensuring high performance and responsiveness to requests from the front-end. As a Senior Software Engineer, you will play a crucial role in the architecture and implementation of innovative solutions that meet our business needs. Responsibilities Software Development: Develop high-quality software solutions, adhering to coding standards, best practices, and SOLID principles. System Design: Participate in the design and architecture discussions, providing insights and suggestions for scalable and efficient system design. Feature Implementation: Implement new features and functionalities, ensuring they meet the requirements and are delivered within the specified timelines. Troubleshooting: Investigate and troubleshoot issues reported in production environments, providing timely resolutions to minimize downtime. Code Review: Conduct and participate in code reviews, offering constructive feedback to ensure code quality and maintainability. Collaboration: Collaborate with cross-functional teams including product managers, designers, and other developers to deliver comprehensive solutions. Documentation: Document code, processes, and procedures to facilitate knowledge sharing and maintain system integrity. Continuous Improvement: Stay updated with the latest industry trends, technologies, and best practices, and proactively suggest improvements to enhance system performance and efficiency. Requirements Bachelors Degree: Bachelors degree in Computer Science, Software Engineering, or a related field. Experience: 3-5 years of professional experience, with a strong understanding of object-oriented programming principles. NET Technologies: Experience with .NET web development, building REST web services; .NET desktop application, NUnit and Windows Service development. We use a combination of .NET Framework, Core, and Standard. Experience with ASP.NET Web Services, MVC and WCF is a plus. DBS Technologies: Experience with MS SQL, PostgreSQL, and Entity Framework Core. T-SQL is a plus. Web Technologies: Experience with HTML, CSS, JavaScript, JQuery and related Microsoft stack technologies. Version Control: Proficiency with version control systems, preferably Git, and experience with branching strategies and pull request workflows. Problem-Solving: Strong analytical and problem-solving skills with the ability to debug and troubleshoot complex issues efficiently. Agile & DevOps : Familiarity with Agile development methodologies and DevOps Preferred Qualifications: Storage : Previous experience working with or implementing storage technologies like Microsoft VSCS, or similar proprietary technologies. Experience with MS Graph API and SharePoint API is a plus. Continuous Integration/Continuous Deployment (CI/CD): Experience with CI/CD pipelines using tools like TeamCity, Jenkins, SonarQube. Cloud Platforms: Knowledge of cloud platforms such as especially Google Cloud Platform and Azure, and experience architecting for and deploying applications on these platforms is desirable. Role: Blockchain Quality Assurance Engineer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Quality Assurance and Testing Education UG: Any Graduate PG: Any Postgraduate Key Skills continuous integrationcssci/cdjquerysqlgitpostgresqlgcpdevopsjenkinsteamcityhtmlmvcwcfrestcdsoftware developmententity frameworkversion controlmicrosoft azurejavascriptsql servernunitagilegraph apiaspnet web services

Job description A Snapshot of Your Day Proficient in a domain expertise in SnapLogic and poised to take on the role of Integration Architect ! Your recognitions will be global since you will be supporting several Bus with ~70K users. You will be provided an atmosphere to learn & develop your skills in various dimensions & technologies. How You ll Make an Impact Implementing the integration scenarios based on the provided inputs and advising for possible improvements on the proposed solutions. https: / / www.siemens-energy.com / employeevideo read more Key Skills as2web servicessoaorder fulfillmentjdbcsalesforcesap s hanajmsapplication integrationwsdlsnaplogicxmlopen apix12jsonapiprotocolscrmpythonerpsaporacleftpedifactjavascripttransitionrest architectureesbintegrationhttpsoap

Job description Job Title: Performance Testing (GCP) Location: Chennai Experience: 4-9 Years Job Summary: We are seeking an experienced Performance Test Engineer with a strong background in LoadRunner , JMeter (minimum 4 years), and scripting knowledge in Python or Java . The ideal candidate will have hands-on experience with Google Cloud Platform (GCP) and performance monitoring tools such as Dynatrace, New Relic, or AppDynamics . Strong analytical and communication skills are essential for collaborating with cross-functional teams and delivering high-quality performance solutions. Key Responsibilities: Design, develop, and execute performance, load, stress, and scalability tests using LoadRunner and JMeter . Create performance test scripts using Python or Java as required by project needs. Analyze performance test results and identify bottlenecks and system limitations. Work closely with development, DevOps, and infrastructure teams to address performance issues. Utilize monitoring tools (e.g., Dynatrace, New Relic, AppDynamics) to collect performance metrics and provide actionable insights. Design and maintain performance test scenarios in GCP environments . Document test strategies, plans, scenarios, results, and recommendations. Participate in performance tuning and optimization efforts. Present detailed performance reports to technical and non-technical stakeholders. Required Skills: 4+ years of hands-on experience with JMeter and LoadRunner . Strong scripting capabilities in Python or Java . Hands-on experience with Google Cloud Platform (GCP) . Proficiency with performance monitoring tools like Dynatrace, New Relic , or AppDynamics . Solid understanding of system architecture, network protocols, and performance KPIs. Excellent communication, collaboration, and analytical skills. Role: Performance Testing Engineer Industry Type: Recruitment / Staffing Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Quality Assurance and Testing Education UG: Any Graduate PG: Any Postgraduate Key Skills Analytical skillsSystem architecturePerformance tuningMonitoring toolsGCPappdynamicsPerformance testingPerformance monitoringPythonTesting