Job description The Apex Group was established in Bermuda in 2003 and is now one of the world s largest fund administration and middle office solutions providers. Our business is unique in its ability to reach globally, service locally and provide cross-jurisdictional services. With our clients at the heart of everything we do, our hard-working team has successfully delivered on an unprecedented growth and transformation journey, and we are now represented by over circa 13,000 employees across 112 offices worldwide.Your career with us should reflect your energy and passion. That s why, at Apex Group, we will do more than simply empower you. We will work to supercharge your unique skills and experience. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. read more Key Skills CVSTalent acquisitionFund administrationApexRecruitment

Job description Technology Innovation Specialist LOCATION : Hyderabad Telangana, India JOB TYPE :FULL TIME Role Purpose A leading Multinational Bank is transforming its Security function into a product-driven, technology-enabled capability. This role is designed for a product-minded innovator who can identify high-impact problems, rapidly prototype solutions, and scale them across a large enterprise.The Innovation Specialist will operate like a Product Manager within a Security organisation, focusing on automation, AI-driven insights, and platform thinking while working closely with security, engineering, and business stakeholder Our ambition: Enable C-suites to act faster, smarter, and with absolute confidence driving rapid digital transformation in risk management. Key Responsibilities Product Ownership Innovation Own the end-to-end lifecycle of internal products and platforms used by security and risk teams Identify inefficiencies and translate them into clear product problem statements and roadmap Define measurable outcomes such as productivity gains, cost reduction, and decision-quality improvement Automation Solution Prototyping Build proof-of-concepts and MVPs using Python for automation, data processing, and integrations Design workflow automations that reduce manual effort across large operational teams Integrate with enterprise systems, APIs, and data sources Stakeholder Collaboration Act as a bridge between business users, security teams, and engineering Work with senior stakeholders to prioritise initiatives based on impact and feasibility Partner with internal platform teams and external vendors to evaluate emerging technologies Core Experience (Updated) 6 10 years of experience in Data Engineering, Platform Engineering, Automation, Product Management or Innovation roles Background in technology-led problem solving within large, complex organisations Prior exposure to risk, compliance, security, or regulated environments is beneficial but not mandatory Use of AI in all of the above Technical Functional SkillsTechnical Skills Hands-on Python and SQL experience for scripting, automation, data manipulation, and API integrations Experience working with enterprise systems, cloud platforms, or internal tooling ecosystems Comfort with modern development practices and iterative delivery AI Prompt Engineering Practical experience working with LLMs and GenAI platforms Strong prompt engineering skills, including: Structured and multi-step prompting Prompt optimisation for consistency and accuracy Techniques to validate and control AI outputs Ability to translate AI capabilities into real business value Product Mindset Strong product thinking: user empathy, prioritisation, and outcome-focused execution Ability to operate in ambiguous problem spaces and convert ideas into shipped solutions Excellent communication and stakeholder management skills Education Bachelor's or Master's degree in Engineering, Computer Science, Data Science, or a related field Graduation from a reputed institute (IITs, NITs, IISc, IIITs, top global universities, or equivalent premier institutions) is strongly preferred Preferred Strong experience building or owning internal enterprise products or platforms Design, test, and optimise prompts for LLM-based enterprise use cases Develop AI-assisted tools such as: Decision-support copilot Intelligent summarisation and insights generation Workflow orchestration using GenAI Establish prompt standards, evaluation methods, and usage guardrails Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Advisor / Consultant Industry Type: Management Consulting Department: Human Resources Employment Type: Full Time, Permanent Role Category: HR Business Advisory Education UG: Any Graduate PG: Any Postgraduate Key Skills pythonmanagement skillsdata processingproblem solvingengineeringdata engineeringsqlscriptingproduct managementcomputer sciencestakeholder managementcomplianceintegrationprocessingapitechnical skillscommunication skillsarchitecture

Job description We are looking for a highly skilled and experienced Placement Specialist to join our team at FutureNse Technologies Private Limited. The ideal candidate should have experience in placement and hiring for client companies in the AI, ML, Data Science domain. Roles and Responsibility Develop and implement effective recruitment strategies to attract top talent. Build and maintain strong relationships with clients and candidates in the AI, ML, Data Science domain. Conduct thorough interviews and assessments to ensure the best fit for each role. Collaborate with internal teams to understand hiring needs and develop targeted recruitment plans. Manage job postings, resumes, and other recruitment materials efficiently. Analyze recruitment metrics to identify areas for improvement and optimize processes accordingly. Job Requirements Proven experience in placement and hiring for client companies in the AI, ML, Data Science domain. Strong understanding of the recruitment process and industry trends. Excellent communication, negotiation, and interpersonal skills. Ability to work independently and as part of a team. Strong analytical and problem-solving skills. Familiarity with recruitment software and tools is an advantage. About Company FutureNse Technologies Private Limited is a leading company in the AI, ML, Data Science domain, committed to delivering innovative solutions and services to its clients. We are a dynamic and fast-paced environment, offering opportunities for growth and development to our employees. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Placement / Alumni Officer Industry Type: Education / Training Department: Teaching & Training Employment Type: Full Time, Permanent Role Category: University Level Educator Education UG: Any Graduate PG: Any Postgraduate Key Skills staphysical designscreeningsoftwarehiringprimetimelvshrsdtiming analysisfloorplansourcingphysical verificationtalent acquisitionfloor planningtiming closuredrcrecruitmentpnrnegotiationplacementtclcommunication skills

Job description Role & responsibilities We are seeking an experienced IT Administrator to manage and maintain our computer systems, networks, and infrastructure. The successful candidate will ensure the smooth operation of our IT systems, provide technical support to employees, and implement new technologies to improve efficiency. 1. System Administration: Manage and maintain computer systems, servers, and networks. 2. Technical Support: Provide technical support to employees, resolving hardware and software issues. 3. Network Administration: Configure and manage network devices, ensuring optimal performance and security. 4. Security: Implement and maintain security measures to protect against cyber threats. 5. Data Backup and Recovery: Develop and implement data backup and recovery procedures. 6. IT Projects: Assist in planning and implementing new IT projects and technologies. 7. Troubleshooting: Troubleshoot hardware and software issues, resolving problems efficiently. 8. Documentation: Maintain accurate documentation of IT systems, processes, and procedures. PREFERED RESIDING WESTERNLINE CANDIDATE hr@arikaholidays.com MS.SARIKA - 9920180304 Role: IT Operations Management Industry Type: Travel & Tourism Department: IT & Information Security Employment Type: Full Time, Permanent Role Category: IT Infrastructure Services Education UG: Graduation Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills System Administration Technical SupportNetwork AdministrationNetwork TroubleshootingTroubleshootingData Backup

Job description Position Technical Support Executive (Accounting) About JiBe JiBe is a cloud based fully integrated ERP system designed for the Maritime industry. Our goal is to allow commercial ship operators to improve productivity, efficiency and safety levels, while reducing costs. JiBe ERP enables increased automation and streamlining of processes, creating pre-defined work flows and reducing the usage of email and paper. Job Responsibilities Provide application support to end users of our Marine ERP product mainly on Accounting Module and work on quick resolution of issues. Assist new clients through the implementation process and the configuration of the new environment. Troubleshoot application and software related issues and determine the root cause for such issues. Work on defined Service Level Agreements (SLAs) to ensure that our clients receive the best service. Work with development teams throughout the software life cycle ensuring issue resolution and stable software releases. Assist in user training related activities for the JiBe Accounting module. Create help materials documents, help videos, FAQs, and other artifacts for JiBe Accounting module. Qualifications and Skills Any Graduate / B.E. or equivalent with minimum 2+ years of relevant experience. Problem solving skills and ability to priorities tasks effectively. Self-motivated, independent and meticulous with an eye for details. Team player with good interpersonal and communication skills Excellent listening and questioning skills, combined with the ability to interact confidently with clients to establish what the problem is and explain the solution. Basic knowledge of cloud services. Excellent English writing skills with grip on nonverbal (mail) communication Ability to work well as a team player. Strong customer focus Shipping experince in Accounts department will be an added advantage. Role: Finance & Accounting - Other Industry Type: Ports & Shipping Department: Finance & Accounting Employment Type: Full Time, Permanent Role Category: Finance & Accounting - Other Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills AccountingTechnical SupportEnglish Verbal And WrittenTroubleshooting SLA

Job description NA Role: Customer Service Industry Type: IT Services & Consulting Department: Customer Success, Service & Operations Employment Type: Full Time, Permanent Role Category: Customer Success, Service & Operations - Other Education UG: B.Tech / B.E. in Any Specialization Key Skills Skills highlighted with ‘‘ are preferred keyskills Cargo Operations Customer SupportTechnical SupportPLSQL

Job description Sustainability Tool Implementation (Siemens TcPCM), Carbon footprint, Recycled content, Know-How on Scope 1, 2 and 3 emissions, Water and Waste Management Consulting awarenessCost and Carbon balance Compliance management exposureSustainability Tool Implementatio n (Siemens TcPCM), Carbon footprint, Recycled content, Know-How on Scope 1, 2 and 3 emissions, Water and Waste ManagementConsulting awareness Cost and Carbon balance Compliance management exposure read more Key Skills Skills highlighted with ‘‘ are preferred keyskills Teamcenter Waste ManagementCompliance managementCarbon Footprint

Job description Step into a role of an Analyst where you will manage and oversee key finance operations, ensuring compliance and smooth processing of transactions. You may be assessed on key critical skills relevant for success in role such as: Processing of inward /outward including Cross border transactions that are managed by Barclays corporate Operations. This includes all the payment scheme such as IMPS/NEFT/RTGS/NACH. Executive is responsible for the accurate error free and timely processing of day today payment transactions. To process transactions as per specified service level agreements adhering to internal and regulatory guidelines. Desirable skills sets: To perform operational duties in TAT prescribed by the bank with due diligence. Understanding of MS Excel and MS Word. Meticulous, fast learner and able to work with minimum supervision. Able to work independently in a fast-paced working environment. You may be assessed on key critical skills relevant for success in role, such as risk and controls, change and transformation, business acumen, strategic thinking and digital and technology, as well as job-specific technical skills. This role is based in Pune. Purpose of the role To provide resolutions for customer queries/issues and personalise each interaction through the use of multiple communication channels. Accountabilities Collaboration across multiple digital channels to personalise each interaction with a customer. Enhancing the banks digital capabilities when current technology is identified as not yet ready to support. Provision of exceptional customer service to clients by responding to inquiries, resolving issues and handling client requests efficiently. Support the collaboration of internal stakeholders including sales, operational, and risk management teams to meet client needs and expectations, so that transactions are executed accurately and on time. Support teams within the business operations function as needed, including risk management, compliance and collections. Comply with all regulatory requirements and internal policies related to customer care. To provide resolutions for customer queries/issues and personalise each interaction through the use of multiple communication channels. Analyst Expectations To meet the needs of stakeholders/ customers through operational excellence and customer service Perform prescribed activities in a timely manner and to a high standard No people leadership roles at this grade. Execute work requirements as identified in processes and procedures, collaborating with and impacting on the work of team members. Identify escalation of policy breaches as required. Take responsibility for customer service and operational execution tasks. Take ownership for managing risk and strengthening controls in relation to the work you own or contribute to. Deliver your work and areas of responsibility in line with relevant rules, regulation and codes of conduct. Gain and maintain an understanding of own role, how the team integrates to achieve overall objectives, alongside knowledge of the work of other teams within the function. Work within well-defined procedures that may involve a variety of work routines. Demonstrate an understanding of the procedures. Evaluate and select the appropriate alternatives from defined options. Make judgements based on the analysis of factual information. Build relationships with stakeholders and customers to identify and address their needs, in support of a smooth operating process, handling sensitive issues as required. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Insurance Analyst Industry Type: Financial Services Department: BFSI, Investments & Trading Employment Type: Full Time, Permanent Role Category: Life Insurance Education UG: Any Graduate PG: Any Postgraduate Key Skills Due diligenceService levelOperational excellenceSenior AnalystService excellenceRTGSCustomer serviceRisk managementOperationsBusiness operations

Job description Ad Monetization Analyst Location: Bangalore, Karnataka, India (Hybrid) Experience: 1 - 3 Years Job Type: Full-time About the Company: GreedyGame founded in 2013 by Arpit Jain [CEO] is a leading ad-tech company thats been driving app growth and monetization We ve built a sustainable and profitable business for over 7 years without chasing vanity metrics and successfully completed our 0 1 journey, we re now scaling rapidly (1 10 phase). As a Google Publishing Partner, we serve 100M+ daily ad impressions and support 5,000+ apps and games worldwide delivering up to 75% revenue uplift Trusted by brands like Amazon, Dream11, MPL, Sharechat, Treebo, Mobikwik, and 1000+ publishers across 20+ countries. The Products You d Help Build: Pubscale - Our Flagship Product Enables effective monetization, user acquisition, uplift revenue and analyzes business growth all in a single place. Immersive Ads Native, non-intrusive ad formats with features like smart caching, priority loading, and adaptive refresh deliver better UX and higher monetization without annoying popups Offerwall - A reward-based engagement layer that monetizes non-paying users through personalized, high-conversion tasks driving eCPMs up to $1000 in Tier 1 geos and up to 3X more revenue in emerging markets AdX GROW Monetization via Google Ad Manager + premium demand partners and an AI-driven UA engine (GROW) with free credits and optimization support Responsibilities Own performance tracking of Immersive Ads across apps (e.g., eCPM, fill rate, impressions, CTR) Analyze large datasets to identify revenue leakage, underperforming segments, and optimization opportunities Execute and monitor ad operations including campaign setup, pacing, and troubleshooting delivery issues Collaborate with the product team to improve ad formats, placements, and user experience Create and maintain daily/weekly reports using Excel/Google Sheets for performance tracking Work with demand partners and internal stakeholders to ensure optimal ad delivery and monetization Provide actionable insights to improve revenue, retention, and user engagement Requirements 6 months 1 years of experience in Data / Operations / Product Analyst role Strong proficiency in Excel / Google Sheets (must-have) High comfort with numbers and large datasets Good understanding of ad monetization metrics (eCPM, CTR, fill rate, impressions) Strong communication skills for cross-team and partner interactions Ability to translate data into business insights and actions Bonus Points Exposure to Ad-tech / Mobile Ads / Gaming ecosystem Familiarity with Immersive Ads / Native Ads / Offerwalls Basic knowledge of SQL or BI tools (optional) What Makes You a Great Fit You re a strategic thinker who balances technical decisions with long-term maintainability. You adapt quickly to changing requirements and enjoy working in fast-paced, evolving environments. You re a clear communicator able to break down complex ideas for both technical and non-technical stakeholders. You care deeply about user experience, product quality, and business impact Why GreedyGame Opportunity to work on products used by millions see: Pubscale Ownership from Day 1 shape architecture, strategy, and key decisions Learning stipend for books, courses, and conferences (we love curious minds!) internal blogs Flexible hybrid work setup split time between our Bangalore HQ and remote work Comprehensive benefits health insurance, PTO, parental leave, and more A high-growth, inclusive, and engineering-led culture that supports experimentation and impact Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: Business Analyst Industry Type: Advertising & Marketing Department: Data Science & Analytics Employment Type: Full Time, Permanent Role Category: Business Intelligence & Analytics Education UG: Any Graduate PG: Any Postgraduate Key Skills Product qualityProduct AnalystHealth insurancePublishingExcelArchitectureAd operationsTroubleshootingGamingSQL

Job description Role Overview We are seeking a skilled professional to lead CMDB Data Quality Control, CMDB Design Optimization, and CMDB Governance Standards initiatives. This role will ensure the integrity, scalability, and compliance of our Configuration Management Database (CMDB) within ServiceNow, driving operational excellence and ITSM maturity. Key Responsibilities CMDB Data Quality Control Establish and enforce data quality rules, validation processes, and reconciliation mechanisms. CMDB Design Optimization Architect and optimize CMDB structures for scalability, performance, and alignment with ITIL/ITSM best practices. CMDB Governance Standards Define governance frameworks, standards, and policies to ensure CMDB consistency across the enterprise. ServiceNow CMDB Ownership Manage CMDB modules within ServiceNow, ensuring integration with ITSM processes (Incident, Problem, Change, Asset). Stakeholder Collaboration Partner with IT operations, security, and compliance teams to align CMDB with organizational goals. Continuous Improvement Monitor CMDB health, identify gaps, and implement corrective actions to enhance resilience and usability. Required Skills Experience Proven expertise in CMDB management, governance, and optimization. Hands on experience with ServiceNow CMDB design, customization, and integration. Strong knowledge of ITIL/ITSM frameworks and configuration management principles. Ability to enforce data quality controls and lead governance initiatives. Excellent communication and stakeholder management skills. Disclaimer : This job posting has been aggregated from external source. Role details, content, and availability are subject to change. Applicants are advised to confirm the latest information directly on the company website before applying. Role: System Analyst Industry Type: IT Services & Consulting Department: IT & Information Security Employment Type: Full Time, Permanent Role Category: IT Infrastructure Services Education UG: Any Graduate PG: Any Postgraduate Key Skills Operational excellenceConfiguration managementReconciliationITSMData qualityManager Quality ControlIT operationsStakeholder managementContinuous improvementITIL