Job description About the Role : As a Backend Systems- Senior Software Engineer you're expected to support existing functionalities by addressing historical issues and contributing towards tech debt. You're also expected to build new features that are part of the Development Roadmap. What you'll be doing : - Understand business requirements and identify the best approach to serve the requirement without risking the system conceptual sanity. - Drive Implementation approach discussions by taking complete ownership of partially defined problems. - Practice TDD and help us retain/improve our code coverage. - Optimize flows within systems for better performance in response times and memory consumption. - Tear down unused flows and concepts to make way for the new and evolved ones. What are we looking for? - Someone with 3+ years of hands-on experience with Core Java, Spring Boot/Hibernate, Rest API. - Someone who has worked on PostgreSQL or MySQL. - Someone who has experience on KAFKA/SQS (Any messaging Queue) & Redis/Memcached(Any Cache system). - Someone who has understanding of design principles and accepted software design practices. - Experience with Microservices, Docker, and Kubernetes is a plus. - Knowledge of any Cloud platform (AWS/GCP/Azure). - Someone who can work both independently and in collaboration with the team as and when the situation demands for it. - Someone who is not averse to learning and growth and has an open mind about inputs/suggestions from any stakeholder. Bonus point if you have : - Experience in the Fintech domain and/ or B2C product experience. - Experience in Spring WebFlux or Python + DJango is a plus. - An engineering degree in Computer Science. Role: Data Platform Engineer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: B.Tech/B.E. in Any Specialization PG: Any Postgraduate Doctorate: Doctorate Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills Java AzurePostgreSQLRedisRest APIMicroservicesSpring Boot/HibernateSQLDJangoCore JavaDockerTDDGCPKAFKAAWSMemcachedKubernetesPython

Job description We're HiringPython Developer! We are looking for an experienced Python Developer to join dynamic team in Pune, India The ideal candidate will possess a strong background in software development and be proficient in writing efficient, reusable code You will play a key role in designing and implementing scalable applications while collaborating with cross-functional teams. “ LocationPune, India Work ModeHybrid ’ RolePython Developer Experience5+ years What Were Looking For Proven experience designing, building, and operating data-oriented solutions in a high volume, transactional, global, industry Experience with advertising technology (AdTech) highly desired. Proven experience developing simple / scalable / reliable architectures, building, and operating concurrent, distributed systems, and solving difficult and novel problems Proven experience in developing data structures and algorithms, including experience working with ML/AI solutions. Proven experience and a passion for developing and operating data-oriented and/or full stack solutions using Python, Javascript/Typescript, Airflow/Composer, Node, Kafka, Snowflake, BigQuery, and a mix of data platforms such as Spark, Hadoop, AWS Athena, Postgres and Redis Excellent SQL development, query optimization and data pipeline development skills required Strong experience using public cloud platforms including AWS and GCP is required; experience with docker and Kubernetes strongly preferred. Proven experience in developing data structures and algorithms Experience supporting ML/AI highly desirable. Proven experience in modern software development and testing practices, with a willingness to share, partner and support and coach other engineers, product people, and operations Experience in employing TDD, BDD or ATDD highly desirable. Proven experience contributing to the development of principles, practices, and tooling supporting agile, testing/QA, DevSecOps, automation, SRE Experience in Trunk Based Development, XP, & implementing CI/CD highly desirable. Experience in SaaS product engineering and operations highly desirable. A focus on continuous learning and improving, both technically and professionally, in your industry, for you and your teams. Demonstrated resilience, with experience working in ambiguous situations. What You'll Do Develop software as a member of one of our engineering teams, participating in all stages of development, delivery and operations, together with your tech lead, colleagues, Product, Data Science, and Design leaders. Develop solutions that are simple, scalable, reliable, secure, maintainable, and make a measurable impact. Develop and deliver new features, maintain our product, and drive growth to hit team KPIs. Employ modern pragmatic engineering principles, practices, and tooling, including TDD/BDD/ATDD, XP, QA Engineering, Trunk Based Development, Continuous Delivery, automation, DevSecOps, and Site Reliability Engineering. Contribute to driving ongoing improvements to our engineering principles, practices, and tooling Provide support & mentorship to junior engineers, prioritising continuous learning and development. Develop and maintain a contemporary understanding of AdTech developments, industry standards, partner and competitor platform developments, and commercial models, from an engineering perspective Combined these insights with technical expertise to contribute to our strategy and plans, influence product design, shape our roadmap, and help plan delivery. Ready to take your career to the next levelš" Apply now and join us on this exciting journey! Show more Show less Role: Data Platform Engineer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: B.Tech/B.E. in Any Specialization PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills public cloudsql developmentsoftware developmentcloud platformsquery optimization kubernetesredisartificial intelligencesqldockerpostgresqlsp

Job description š" We're hiring API Developer for a leading product based company! š" We are seeking a talented and experienced API Developer to join dynamic development team The successful candidate will be responsible for designing, developing, and maintaining high-performance APIs that enable seamless integration with internal and third-party systems The role requires a strong understanding of RESTful and SOAP APIs, secure data exchange, and best practices for API architecture and documentation. “ LocationRemote Work ModeWork from anywhere ’ RoleAPI Developer Key Responsibilities API Design and Development: Design, develop, and maintain scalable and secure RESTful and SOAP APIs. Develop and implement API standards, including security, authentication, and data integrity. Create and manage API documentation to ensure clarity and ease of use for internal and external developers. Integration And Data Management Integrate APIs with internal systems, third-party services, and external platforms (e.g., payment gateways, accounting software). Work closely with business analysts and product managers to define integration requirements. Handle data parsing, transformation, and synchronisation across platforms. Performance And Security Monitor and optimise API performance, ensuring low latency and high availability. Implement security protocols, including OAuth, JWT, and API key-based authentication. Ensure compliance with industry standards and data protection regulations (e.g., GDPR). Testing And Debugging Develop and execute unit, integration, and end-to-end tests for APIs. Debug and resolve issues related to API performance and connectivity. Set up automated monitoring and alerting for API failures and errors. Collaboration And Support Work closely with front-end and back-end developers to align API functionality with application needs. Provide technical support and guidance to internal teams and external partners using the APIs. Continuously improve and refine existing APIs based on user feedback and performance analysis. Essential Skills and Experience: ” Proven experience in developing and managing RESTful and SOAP APIs. ” Strong programming skills in JavaScript, Python, Node.js, .NET, or Java. ” Experience with API management platforms (e.g., Postman, Swagger, Apigee). ” Knowledge of security best practices (e.g., OAuth 2.0, JWT). ” Understanding of data exchange formats like JSON, XML. ” Experience with cloud platforms (e.g., AWS, Azure, GCP). ” Strong understanding of version control systems (e.g., Git). ” Must have experience of developing a dedicated API's platform for third parties. Desirable Experience with GraphQL. Familiarity with microservices architecture. Knowledge of containerisation tools (e.g., Docker, Kubernetes). Experience in setting up CI/CD pipelines. Ready to code your future Apply now and be part of our innovative team! Show more Show less Role: Search Engineer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: B.Tech/B.E. in Any Specialization PG: Any Postgraduate Key Skills Skills highlighted with ‘‘ are preferred keyskills javarestjavascriptnodesoap continuous integrationkubernetesci/cdapigeeapi managementswaggerdockermicroservicesgitpostmangcpxmljsondebuggingapigraphqlpythonversion controlmicrosoft azureapplication developmentnode.js.netaws

Job description Are you a Python & Django pro who loves solving complex problems and building scalable applications? Do you thrive in a fast-paced environment where your work makes an impact? If yes, wed love to have you on board! Whats in it for you ? - Work on cutting-edge tech with Python, Django & AWS - Build and optimize high-performance backend systems - Collaborate with a passionate team of developers - Be part of a growing SaaS company making waves in hyperlocal tech Who were looking for : Experience: 4-7 years in backend development - Strong skills in Python, Django, AWS, RESTful APIs - Hands-on with Databases (PostgreSQL/MySQL), Celery, Redis - Comfortable with CI/CD, Git, and asynchronous programming - Onsite role in Pune -(Male candidates preferred)- Key Responsibilities : - Develop, test, and maintain robust and scalable backend applications using Python and Django - Design and implement APIs (RESTful services) to ensure seamless integration with front-end systems - Optimize database performance and manage PostgreSQL/MySQL databases - Work with AWS services to deploy and scale applications in a cloud environment - Utilize Celery for task management and Redis for caching and message brokering. Role: Search Engineer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: B.Tech/B.E. in Any Specialization PG: Any Postgraduate Doctorate: Doctorate Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills DjangoPython gitsaasPostgreSQLMySQLci/cdbackend developmentAWSredis

Job description Key Responsibilities: Design, develop, and optimize relational (PostgreSQL, SQL Server, MySQL, Oracle) and NoSQL (MongoDB, Cassandra, Redis) databases. Write and optimize complex SQL queries, stored procedures, triggers, and functions. Develop and maintain ETL pipelines for data integration. Ensure database security, backups, and high-availability solutions. Collaborate with teams to support application development and troubleshoot performance issues. Maintain technical documentation and stay updated on database best practices. Required Skills: 5+ years of experience in database development. Strong expertise in PostgreSQL and proficiency in SQL Server, MySQL, or Oracle. Experience with query optimization, indexing, and partitioning. Familiarity with NoSQL databases and cloud DB solutions (AWS RDS, Azure SQL, etc.). Hands-on experience with ETL tools, data warehousing, and scripting (Python, PowerShell, Bash). Strong problem-solving and communication skills. Role: Database Administrator Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: DBA / Data warehousing Education UG: Any Graduate PG: CS in Any Specialization Doctorate: Doctorate Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills PostgreSQL PowerShellCassandradata warehousingRedisSQL ServerBashdatabase developmentMySQLSnowflakeMongoDBOracleETLPython

Job description Apptware is Hiring : Senior Python Developer Experience : 6+ Years Location : Pune (Onsite) Key Responsibilities : - Design, develop, and maintain robust, scalable, and high-performance applications using Python. - Develop RESTful or GraphQL APIs and integrate with third-party services. - Optimize application performance and ensure high availability. - Work with both SQL (PostgreSQL, MySQL) and NoSQL (MongoDB, Redis) databases. - Implement efficient data processing pipelines. - Collaborate with frontend developers, DevOps engineers, and product teams. - Write clean, maintainable, and testable code following best practices. - Mentor junior developers and conduct code reviews. - Troubleshoot and resolve software defects and issues. - Stay updated with emerging trends and technologies in Python development. Required Skills & Qualifications : - 5+ years of experience in Python development. - Proficiency in Python frameworks such as Django, Flask, or FastAPI. - Strong knowledge of RESTful APIs and microservices architecture. - Experience with SQL (PostgreSQL, MySQL) and NoSQL (MongoDB, Redis) databases. - Knowledge of asynchronous programming and multi-threading. - Hands-on experience with Docker and cloud platforms (AWS, GCP, Azure). - Understanding of CI/CD pipelines and DevOps practices. - Experience with testing frameworks (PyTest, Unittest) and debugging tools. - Strong understanding of data structures, algorithms, and system design. - Knowledge of message queues (Kafka, RabbitMQ, Celery) is a plus. - Experience with big data technologies (Spark, Dask) is a plus. Good-to-Have : - Experience with Machine Learning and AI-related projects. - Knowledge of Kubernetes and Infrastructure as Code (Terraform, Ansible). - Familiarity with Graph Databases and Knowledge Graphs. Role: Data Platform Engineer Industry Type: IT Services & Consulting Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: B.Tech/B.E. in Any Specialization PG: Any Postgraduate Doctorate: Doctorate Not Required Key Skills Skills highlighted with ‘‘ are preferred keyskills Pandas RDBMSDjangoMicroservices ArchitectureFastAPIAWSAlgorithmData StructurePythonFlask

Job description Power BI Developer to Collaborate with cross-functional teams to deliver data-driven insights and ensure data accuracy. Ideal candidate has strong skills in DAX, Power Query, data modeling, and experience integrating with various data sources. Role: BI Developer Industry Type: IT Services & Consulting Department: Data Science & Analytics Employment Type: Full Time, Permanent Role Category: Business Intelligence & Analytics Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills Data VisualizationsMicrosoft Power BiSQLDaxPower Bi Desktop MDXPower BiChartsPower QueryDax QueriesPower Bi ReportsPower Bi DashboardsPower ViewReports And DashboardsData Analysis ExpressionsTablesAzure Analysis ServicesDashboardsData ModelingPython

Job description Job Summary: The ideal candidate will have a strong background in data analysis, machine learning, and statistical modeling, along with the ability to derive actionable insights from complex data sets. Responsibilities: Data Collection and Preprocessing: Acquire, clean, and preprocess data from various sources to ensure data quality and reliability. Work with big data technologies and tools for efficient data processing. read more Key Skills Skills highlighted with ‘‘ are preferred keyskills Gen AIMachine Learning AlgorithmsLLMPython Natural Language ProcessingSparkAWSDeep LearningSQL

Description Job Title: Data Analyst Intern Location: Jogeshwari, Mumbai Work Type: Full-time Internship | 5 Days Working (On-site) About The Sleep Company The Sleep Company is Indias leading comfort-tech brand, revolutionizing the way people sleep and sit with our patented SmartGRID technology. Rooted in innovation, customer obsession, and an uncompromising focus on quality, we are on a mission to improve lives through better sleep and ergonomics. Internship Overview We are looking for a motivated and detail-oriented Data Analyst Intern to join our team in Mumbai (Jogeshwari). This is a fantastic opportunity to work with real-time data, collaborate across departments, and help drive insights that support decision-making in a fast-growing consumer brand. Key Responsibilities Work closely with the Data & Business teams to gather, clean, and analyze data across various domains (e.g., sales, marketing, customer experience). Create dashboards, reports, and visualizations using tools like Excel, Google Sheets, and BI platforms. Identify trends, patterns, and outliers to support business strategies. Assist in automating repetitive data tasks and generating actionable insights. Present findings to internal stakeholders in a clear and concise manner. Ensure data accuracy and integrity in all reports and analyses. What Were Looking For Currently pursuing or recently completed a degree in Data Science, Statistics, Economics, Engineering, or related fields. Proficiency in Excel/Google Sheets is a must; familiarity with SQL, Python, or BI tools (Power BI/Tableau) is a plus. Strong analytical and problem-solving skills. Attention to detail and a passion for working with data. Eagerness to learn in a fast-paced, collaborative environment. Strong communication and presentation skills. Why Join Us? Experience the pace and impact of a high-growth startup. Be part of a company that values innovation, customer-centric thinking, and data-driven decisions. Work in a collaborative and supportive environment. Mentorship from experienced professionals in analytics and strategy. Duration : Internship duration: 3–6 months Role: Data Science & Analytics - Other Industry Type: Furniture & Furnishing Department: Data Science & Analytics Employment Type: Full Time, Permanent Role Category: Data Science & Analytics - Other Education UG: Any Graduate Key Skills Skills highlighted with ‘‘ are preferred keyskills SQL TableauData Analytics

Job description Description: Our software development team is looking for a talented web developer with strong experience in the latest web technologies to help us build our cutting-edge, next generation web and desktop applications. As part of an agile team, some of the tough challenges you’ll be sure to encounter include creating advanced, data-driven UIs for our clients using latest technologies. Our tech stack includes Visual Studio, .NET Core, C#, Python, JavaScript, HTML, FME, Jquery. TypeScript, Bootstrap. Responsibilities: • Work with technical lead, architect and UX designers to understand the use cases of our customers in order to establish requirements for products, enhancements, new features, and case studies. • Architecting and designing new and existing applications. • Developing, coding, and debugging software. • Development of automated unit and functional tests. • Product design and implementation presentations to team members and management. • Technical support of applications including direct customer support and escalated issues. • Technical advancement via self-motivated research, formal training and course work, and technical conferences. - Minimum Experience: 3-5+ years. Requirements: • BS in a STEM discipline. Preferably Computer Science or Computer Engineering, • Familiarity with modern Web UI tools and technologies: Angular, NodeJS, HTML5, CSS/SCSS/LESS, React • Strong programming skills in following languages: JavaScript and C# • Hands on experience and knowledge of relational and spatial databases (SQL Server, ESRI ArcGIS Geodatabase) • Strong skills and understanding in TypeScript and Bootstrap • Strong understanding of complex software concepts such as: Dynamic Web Applications, REST, MVC, Object oriented design and Interface design, High performance computing • Ability to write high quality source code to program features requiring completion by aggressive deadlines. • Ability to write unit-test cases and conduct functional and non-functional tests. • Willingness to learn cloud integration, including but not limited to deployment of new features/updates to cloud-hosted sites. (AWS framework) Nice to have: Excellent written & verbal communication skills Experience with SQL Server big plus Experience with ArcGIS a big plus Experience with ETL tools highly desirable Familiarity with Open Source tools and languages is a plus Role: Full Stack Developer Industry Type: Oil & Gas Department: Engineering - Software & QA Employment Type: Full Time, Permanent Role Category: Software Development Education UG: Any Graduate Key Skills cssweb applicationarcgisbootstrapjqueryreact.jsopen sourceesri arcgisoopswritinghtmltypescriptsassmvcetlprogrammingcommunication skillsc#restpythonverbal communicationweb uijavascriptsql servervisual studioangularnode.jsweb technologiesleawsfme